Recombinant Cuscuta exaltata Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Introduction to psbB and Its Biological Role

The psbB gene encodes the Photosystem II CP47 chlorophyll apoprotein, a core component of the photosynthetic apparatus in plants. This protein stabilizes chlorophyll and cofactors in the CP47 complex, enabling light-driven water oxidation in Photosystem II (PSII) . In parasitic plants like Cuscuta, plastid genomes often undergo evolutionary reductions, but psbB retention varies, reflecting its critical role in residual photosynthetic activity or plastid maintenance .

Production and Purification Protocol

The recombinant protein is produced via bacterial expression systems, leveraging E. coli for cost-effective scalability. Post-expression steps include:

  1. Purification: Nickel-affinity chromatography exploiting the His-tag .

  2. Quality Control: SDS-PAGE and Western blotting to confirm size (~47 kDa) and tag integrity .

  3. Lyophilization: Trehalose (6%) and Tris/PBS-based buffer stabilize the protein during storage .

Role in Plastid Genome Evolution

In Cuscuta, plastid genomes undergo gene loss as parasitism intensifies. psbB retention or loss serves as a marker for evolutionary transitions:

SpeciespsbB StatusParasitism LevelSource
C. exaltataRetained (photosynthetic)Hemiparasitic
C. strobilaceaLost (holoparasitic)Holoparasitic
C. gronoviiRetainedVariable (hemiparasitic)

Key Findings:

  • psbB loss correlates with reduced photosynthetic capacity, as seen in holoparasitic C. strobilacea .

  • In C. exaltata, psbB evolves under strong purifying selection, indicating functional importance despite reduced photosynthesis .

B. Comparative Analysis with Other Cuscuta Species

Phylogenetic studies group C. exaltata with C. japonica and C. reflexa due to shared plastid genome features, including psbB retention . Structural variations in plastomes (e.g., inverted repeats, gene order) further differentiate species within the genus .

ELISA and Detection

Recombinant Cuscuta exaltata psbB is used in ELISA kits for quantifying protein levels in research samples, aiding studies on plastid function in parasitic plants .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement when placing the order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize the development of the specified tag.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Cuscuta exaltata (Tall dodder)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLSVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWGIAGGTVTNPGLWSYEGVAGAHIAFSGLCFLAAIWHWVYWDL EVFYDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQP LKPAWGAEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSAGLAENQSLSE TWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPIFRDKEGRELFVRRMP TFFETFPVLLVDGDGIVRADVPFRRAESKYSVEQVGVTVAFYGGELNDVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTRRQAV
Uniprot No.

Target Background

Function
Recombinant Cuscuta exaltata Photosystem II CP47 chlorophyll apoprotein (psbB) is a crucial component of the core complex of photosystem II (PSII). It binds chlorophyll and contributes to the catalysis of the primary light-induced photochemical processes within PSII. PSII, a light-driven water:plastoquinone oxidoreductase, utilizes light energy to extract electrons from H(2)O, generating O(2) and a proton gradient that is subsequently used for ATP formation.
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid membrane; Multi-pass membrane protein.

Q&A

What is Cuscuta exaltata and how does its parasitic lifestyle affect its photosynthetic machinery?

Cuscuta exaltata (tall dodder) is a vine-like ectoparasite found primarily in Florida and Texas. It exists in small, vulnerable populations spread across a wide geographic range. As a parasitic plant, C. exaltata has reduced photosynthetic capacity, producing minimal chlorophyll which results in its characteristic orange, yellow-green, or sometimes magenta coloration . It attaches to host plants (primarily woody species like oaks, walnuts, and sumacs) using specialized structures called haustoria, which enable nutrient extraction from the host . This parasitic lifestyle has significant implications for its photosynthetic machinery, with reduced selective pressure to maintain fully functional photosynthetic components. Despite this, C. exaltata and other Cuscuta species retain some photosynthetic genes like psbB, though these may have evolved differently compared to their autotrophic relatives.

What is the CP47 chlorophyll apoprotein and what role does it play in photosynthesis?

The CP47 chlorophyll apoprotein, encoded by the psbB gene, is an integral antenna component of Photosystem II (PSII). It plays a crucial role in light harvesting and excitation energy transfer within the photosynthetic apparatus. CP47 contains 16 chlorophyll molecules whose precise arrangement is essential for efficient excitation energy transfer to the PSII reaction center . This energy transfer ultimately drives the charge separation process that initiates the electron transfer cascade powering oxygenic photosynthesis . The protein-chlorophyll interactions within CP47 are critical for its function, with the protein providing a structural framework that positions the chlorophyll molecules optimally for energy transfer.

How does the study of Cuscuta photosystems contribute to our understanding of photosynthetic evolution?

Studying photosystems in parasitic plants like Cuscuta provides unique insights into the evolutionary trajectory of photosynthetic machinery under reduced selective pressure. Despite their parasitic lifestyle, Cuscuta species retain functional and non-functional fragments of photosynthetic genes, including psbB . The presence of these genes, some with evidence of horizontal gene transfer (HGT) or intracellular transfer between organelles, reveals complex evolutionary processes . For instance, research on Cuscuta mitochondrial genomes has identified regions corresponding to plastid genes like psbB, suggesting potential gene transfer events between organelles . These findings contribute to our understanding of how parasitic plants evolve from autotrophic ancestors and how photosynthetic machinery can be modified or repurposed during this evolutionary transition.

How do the excitation energies of chlorophylls in CP47 from Cuscuta exaltata potentially differ from those in autotrophic plants?

The excitation energies of chlorophylls in CP47 are heavily influenced by their protein environment. In autotrophic plants and cyanobacteria, quantum mechanics/molecular mechanics (QM/MM) approaches have revealed that the electrostatic effects of the protein significantly impact chlorophyll site energies . In the case of Cuscuta exaltata, which produces less chlorophyll as an adaptation to its parasitic lifestyle , potential differences in protein structure or post-translational modifications could alter these electrostatic interactions. Research on cyanobacterial PSII has identified specific chlorophylls (B3 followed by B1) as the most red-shifted within CP47 , but in C. exaltata, the ranking of site energies might differ due to adaptive evolutionary changes. These differences would be particularly significant at the functionally critical chlorophyll-protein interfaces where slight structural variations could substantially alter energy transfer pathways.

How might horizontal gene transfer events influence the structure and function of CP47 in Cuscuta species?

Horizontal gene transfer (HGT) appears to be a significant evolutionary mechanism in Cuscuta species, with evidence of extensive HGT into nuclear genomes from host plants . While the search for HGT into mitochondrial genomes of C. australis and C. campestris found little evidence, the nuclear genomes showed potential HGT candidates . For CP47 in particular, any HGT events affecting the psbB gene could introduce novel sequence variations that might alter protein structure and function. These variations could affect chlorophyll binding sites, protein-protein interaction surfaces, or membrane integration domains. Identifying such HGT events requires comprehensive phylogenetic analysis comparing psbB sequences across Cuscuta species and potential donor lineages. The functional consequences of any identified transfers would need to be assessed through recombinant protein studies examining structural stability, chlorophyll binding affinity, and energy transfer efficiency.

What expression systems are most suitable for producing recombinant CP47 from Cuscuta exaltata?

Expression of membrane proteins like CP47 presents significant challenges for recombinant production. For the CP47 chlorophyll apoprotein from C. exaltata, several expression systems warrant consideration, each with distinct advantages:

Expression SystemAdvantagesLimitationsSpecial Considerations
E. coliHigh yield, low cost, rapid growthLacks chlorophyll, membrane differencesMay require chlorophyll supplementation, detergent optimization
Cyanobacterial hostsNative-like membrane environment, chlorophyll availabilityLower yields, more complex manipulationBetter for functional studies requiring assembled photosystems
Plant chloroplast transformationMost native-like environmentTechnical complexity, lower yieldsBest for in vivo functional studies
Cell-free systemsControl over translation environmentExpensive, technical challenges with membrane proteinsAllows controlled addition of chlorophyll and membrane mimetics

Given the importance of chlorophyll-protein interactions for CP47 structure and function, expression systems that provide chlorophyll (cyanobacteria or plant chloroplasts) would be preferable for functional studies, while E. coli or cell-free systems might be more suitable for structural studies where chlorophyll can be added during purification or reconstitution steps.

What spectroscopic methods are most informative for analyzing CP47-chlorophyll interactions?

Spectroscopic techniques are essential for characterizing CP47-chlorophyll interactions, especially when studying a parasitic plant like C. exaltata with altered photosynthetic properties. A comprehensive analysis would employ multiple complementary techniques:

  • Absorption spectroscopy: Provides initial characterization of chlorophyll binding and stoichiometry

  • Circular dichroism (CD): Reveals information about protein secondary structure and chlorophyll arrangement

  • Fluorescence spectroscopy: Measures energy transfer and quenching properties

  • Time-resolved spectroscopy: Captures dynamic aspects of energy transfer

  • Resonance Raman spectroscopy: Provides detailed information about chlorophyll-protein interactions

For CP47 from C. exaltata, comparing spectroscopic profiles with those of autotrophic plants would be particularly valuable for identifying functional differences related to its parasitic lifestyle. High-level quantum chemical calculations, similar to the time-dependent density functional theory approaches used in cyanobacterial PSII studies , would be necessary to interpret experimental spectra and develop a comprehensive model of excitation energy transfer within the protein.

How can researchers effectively isolate and purify thylakoid membrane fractions from Cuscuta exaltata?

Isolating thylakoid membrane fractions from C. exaltata presents unique challenges due to its parasitic nature and reduced chloroplast development. A modified protocol might include:

  • Careful selection and collection of C. exaltata tissue, ideally from regions with the highest chlorophyll content (appearing yellow-green rather than orange or magenta)

  • Gentle mechanical disruption in an isotonic buffer containing protease inhibitors

  • Differential centrifugation steps optimized for the less abundant and potentially more fragile thylakoid membranes

  • Sucrose gradient purification to separate thylakoid membranes from other cellular components

  • Verification of fraction purity using Western blotting with antibodies against known thylakoid proteins

For ribosome profiling studies examining co-translational membrane engagement, additional considerations include rapid tissue freezing to preserve the translation state and careful separation of membrane-bound and soluble ribosomes . The reduced chlorophyll content in C. exaltata means that standard protocols developed for model plants would need significant optimization, with particular attention to preventing proteolytic degradation of the less abundant photosystem components.

How should researchers distinguish between translation defects and protein stability issues when studying CP47 in Cuscuta exaltata?

For C. exaltata CP47 research, this distinction requires careful experimental design:

  • Ribosome profiling to directly measure translation rates independently of protein stability

  • Pulse-chase experiments with short labeling periods to capture translation before degradation occurs

  • Comparison of protein levels with and without protease inhibitors to assess degradation rates

  • Measurement of mRNA association with polysomes to determine translation initiation rates

These approaches would help determine whether any observed reduction in CP47 levels in C. exaltata results from evolutionary adaptations affecting translation or simply from reduced stability due to limited chlorophyll availability in this parasitic plant.

What contradictions exist in the literature regarding chlorophyll-dependent translation, and how do they apply to Cuscuta research?

The literature presents significant contradictions regarding chlorophyll's role in regulating the translation of its binding proteins, with direct relevance to Cuscuta research. Several studies using in vivo and in organello pulse-labeling suggest that chlorophyll synthesis onset coincides with increased synthesis rates of chlorophyll-binding apoproteins, implying translation activation by chlorophyll . Experiments with chlorophyll-deficient Chlamydomonas and Synechocystis showed diminished PsbA labeling, supporting this activation hypothesis .

Conversely, other research provides evidence that chlorophyll primarily stabilizes nascent proteins without affecting their synthesis rates . Studies identified specific ribosome pausing sites on the psbA mRNA potentially enabling chlorophyll binding, but these pausing patterns remained unchanged between dark-grown and briefly illuminated plants, contradicting a chlorophyll-mediated pausing mechanism .

For Cuscuta research, these contradictions necessitate careful experimental approaches that can definitively separate translation effects from stability issues. The parasitic nature of Cuscuta with its reduced chlorophyll content provides a unique natural system to potentially resolve these contradictions by studying how translation mechanisms have adapted to limited chlorophyll availability.

How might the study of recombinant CP47 from Cuscuta exaltata inform conservation strategies for this vulnerable species?

Cuscuta exaltata exists in small, vulnerable populations across Florida and Texas, with habitat destruction and intentional removal by landowners representing significant threats . Research on its CP47 protein could inform conservation strategies by:

  • Providing molecular markers to assess genetic diversity across remaining populations

  • Identifying unique adaptive features in its photosynthetic machinery that could highlight its evolutionary significance

  • Developing a better understanding of its ecological requirements based on photosynthetic capacity

  • Creating educational materials demonstrating its scientific value to reduce intentional removal

  • Establishing protocols for ex situ conservation that account for its specialized parasitic lifestyle

Additionally, understanding the molecular adaptations in photosynthetic proteins like CP47 could help predict how C. exaltata might respond to changing environmental conditions, informing habitat management decisions for this ecologically unique parasitic plant.

What insights could comparative studies of CP47 across different Cuscuta species provide about parasitic plant evolution?

Comparative studies of CP47 across Cuscuta species at different stages of parasitic evolution could reveal molecular mechanisms underlying the transition from autotrophy to heterotrophy. Research on mitochondrial genomes of C. australis and C. campestris has already identified interesting patterns of gene transfer and conservation , suggesting that similar comparative approaches with CP47 would be informative.

Such studies might examine:

  • Sequence variations in the psbB gene correlating with the degree of parasitism

  • Changes in chlorophyll binding sites reflecting reduced selective pressure

  • Modifications to co-translational membrane engagement mechanisms

  • Evidence of convergent evolution across independently evolved parasitic lineages

  • Patterns of gene transfer that might have influenced CP47 structure and function

This comparative approach would contribute to our broader understanding of how essential photosynthetic components evolve when selective pressure is relaxed, potentially revealing general principles about molecular evolution during the transition to parasitism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.