Recombinant Cuscuta exaltata Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Description

Research Applications

This recombinant protein is instrumental in studying:

  1. Parasitic Plant Evolution: Cuscuta species exhibit plastid genome reduction but retain core photosynthetic genes. The Q(B) protein aids in understanding how parasitism impacts plastid function and gene retention .

  2. Photosynthetic Mechanisms: Functional assays (e.g., electron transport analysis) can elucidate how Q(B) modulates PSII efficiency in low-light environments .

  3. Protein Engineering: The His-tag enables purification for structural studies (e.g., X-ray crystallography) to resolve PSII dynamics .

Comparative Analysis with Related Proteins

FeatureC. exaltata Q(B) C. obtusiflora Q(B)
UniProt IDA8W3A5A8W3H2
Sequence Length344 aa353 aa
TagHis (variable position)N-terminal His
Purity>90% (SDS-PAGE)>90% (SDS-PAGE)
Storage-20°C/-80°C (with glycerol)-20°C/-80°C (with trehalose)

Key Insight: While C. exaltata and C. obtusiflora share functional Q(B) proteins, differences in plastid genome architecture (e.g., loss of RNA polymerase genes in C. obtusiflora) highlight species-specific evolutionary adaptations .

Handling and Stability

  • Reconstitution: Centrifuge vials before opening; dissolve in deionized water at 0.1–1.0 mg/mL. Add 5–50% glycerol for long-term storage .

  • Avoid: Repeated freeze-thaw cycles; store working aliquots at 4°C for ≤1 week .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Cuscuta exaltata (Tall dodder)
Target Names
psbA
Target Protein Sequence
MTAILERRESENLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H2O, generating O2 and a proton gradient subsequently used for ATP formation. It comprises a core antenna complex that captures photons and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, as well as several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid membrane; Multi-pass membrane protein.

Q&A

What is the biological significance of Photosystem Q (B) protein in Cuscuta species?

The Photosystem Q (B) protein in Cuscuta species represents a fascinating case of evolutionary adaptation in parasitic plants. While many Cuscuta species have reduced photosynthetic capacity, they maintain varying degrees of photosynthetic machinery. Research indicates that plastid genes in parasitic plants like Cuscuta undergo changes in nucleotide substitution rates compared to their photosynthetic relatives . The plastid genes matK and rbcL typically show higher substitution rates in holoparasitic species, reflecting the relaxed selection pressure on photosynthesis-related proteins .

Methodologically, researchers should approach this question through comparative genomics, examining sequence conservation across Cuscuta species with different degrees of parasitism. Immunological detection techniques similar to those used for MatK protein can be valuable for characterizing protein expression levels in different tissues .

How do expression patterns of photosynthetic proteins differ between Cuscuta exaltata and other Cuscuta species?

Expression patterns of photosynthetic proteins across Cuscuta species correlate with their degree of parasitism. While specific data on Cuscuta exaltata is limited in current literature, research methodologies can be adapted from those used to study plastid gene expression in other parasitic plants.

RNA gel blot hybridization and microarray analyses as demonstrated in transplastomic studies of MatK provide effective approaches for analyzing transcript accumulation patterns . When examining protein expression, immunological detection using epitope-tagged recombinant proteins allows for sensitive quantification, as demonstrated in the AmatK tobacco lines .

To properly analyze differences between species, researchers should:

  • Collect tissues at equivalent developmental stages

  • Include appropriate controls for developmental variation

  • Normalize expression data to account for genome-wide differences

  • Consider environmental influences on expression patterns

What structural features distinguish photosystem proteins in parasitic plants from their autotrophic relatives?

Structural analysis of photosystem proteins from parasitic plants reveals adaptations reflecting their unique lifestyle. While specific structural data for Cuscuta exaltata Photosystem Q (B) protein is not extensively documented, general patterns observed in parasitic plant proteins can guide research approaches.

Methodologically, researchers should:

  • Conduct sequence alignment analyses focusing on functional domains

  • Identify conserved versus variable regions across parasitic and non-parasitic relatives

  • Use bioinformatic tools to predict structural changes and their functional implications

  • Apply X-ray crystallography or cryo-EM to determine three-dimensional structures

The higher substitution rates observed in plastid genes of parasitic plants suggest potential structural modifications . These modifications may reflect either relaxed selection or adaptive changes related to the parasitic lifestyle.

What are the key technical challenges in isolating functional Photosystem Q (B) protein from Cuscuta species?

Isolating functional photosystem proteins from parasitic plants presents several technical challenges that require methodological adaptations:

  • Limited biomass availability: Unlike conventional crop species, Cuscuta material may be difficult to obtain in large quantities

  • Host contamination: When grown on hosts, careful separation of parasitic tissue is essential

  • Protein integrity: Photosystem proteins are membrane-associated and require appropriate detergents for solubilization

  • Post-translational modifications: These may differ in parasitic species and affect functionality

  • Functional assessment: Standard assays for photosynthetic activity may require modification

The experimental approaches used for recombinant MatK expression provide valuable methodological guidance, particularly the use of epitope tagging for detection and purification . When designing purification protocols, researchers should consider using affinity tags that minimize interference with protein function, as demonstrated by the C-terminal HA tagging approach that preserved MatK splicing activity .

What expression systems yield optimal results for recombinant Cuscuta photosystem proteins?

The selection of an appropriate expression system for recombinant Cuscuta photosystem proteins requires careful consideration of multiple factors. Based on research with other plastid proteins, several approaches offer promising results:

  • Chloroplast transformation systems: The transplastomic approach using tobacco plastid transformation has proven effective for plastid proteins like MatK . This system allows for proper folding and post-translational modifications of photosynthetic proteins.

  • Inducible expression systems: For potentially toxic proteins, inducible systems like the theophylline-responsive riboswitch used in the AmatK study provide controlled expression . This approach allows for the expression of proteins that might be lethal when constitutively expressed.

  • Heterologous systems with codon optimization: When using E. coli or yeast expression systems, codon optimization should account for the altered evolutionary rates observed in parasitic plant genes .

Expression SystemAdvantagesDisadvantagesKey Methodological Considerations
Tobacco chloroplastNative-like environment, high yieldSlow generation timeUse homologous recombination for targeted integration
E. coliFast, high yieldLacks post-translational modificationsCodon optimization, fusion partners for solubility
YeastEukaryotic modificationsLower yield than bacteriaOptimize signal sequences for proper localization
Cell-free systemsRapid, avoids toxicityLimited post-translational processingSupplement with chloroplast extracts for authentic folding

How can structural biology approaches be optimized for studying recombinant Cuscuta photosystem proteins?

Structural characterization of recombinant photosystem proteins from Cuscuta requires adaptations of standard methodologies:

  • Protein stabilization: Membrane proteins often require specific detergents or lipid environments. Screening multiple conditions is essential for maintaining native conformation.

  • Crystallization strategies: For X-ray crystallography, consider antibody-mediated crystallization or lipidic cubic phase techniques optimized for membrane proteins.

  • Cryo-EM approaches: Single-particle analysis can be particularly valuable for larger photosystem complexes, potentially avoiding crystallization challenges.

  • NMR studies: For smaller domains, solution NMR with isotope labeling provides dynamic information. Expression systems must be adapted for isotope incorporation.

The approach used for MatK protein detection, employing a C-terminal tag that preserves function, illustrates the importance of tag placement in structural studies . Researchers should verify that structural modifications for detection or purification do not alter function or conformation.

What molecular mechanisms explain the functional differences between photosystem proteins in parasitic and autotrophic plants?

Understanding the molecular basis of functional differences in photosystem proteins requires integrative approaches:

  • Site-directed mutagenesis: Creating chimeric proteins or point mutations at divergent residues can identify functionally critical differences.

  • Evolutionary analysis: Comparing synonymous and non-synonymous substitution rates helps distinguish neutral from adaptive changes, as demonstrated in studies of parasitic plant plastid genes .

  • Protein-protein interaction studies: Co-immunoprecipitation with tagged recombinant proteins can reveal altered interaction networks. This approach proved valuable for identifying MatK-associated RNA targets .

  • In vivo functional assays: Complementation studies in transplastomic plants can test functional equivalence between parasitic and autotrophic proteins.

RNA co-immunoprecipitation assays have successfully identified targets of MatK protein , suggesting that similar approaches could reveal functional partners of Photosystem Q (B) protein in Cuscuta species.

How do laboratory cultivation conditions affect the expression and functionality of recombinant Cuscuta photosystem proteins?

Environmental and cultivation conditions significantly impact the expression and functionality of recombinant photosystem proteins:

  • Light conditions: Standard growth chamber conditions (25°C, humidity 55%, 16h light/8h dark) have been successfully employed for transplastomic plants expressing plastid proteins .

  • Media composition: Media containing 30 g/L sucrose supports growth of transplastomic plants expressing plastid proteins . For parasitic plants, media may need optimization to compensate for reduced photosynthetic capacity.

  • Selection approaches: Spectinomycin resistance (500 mg/L) provides effective selection for transplastomic lines .

  • Inducer concentration: For inducible systems, concentration optimization is critical. The theophylline-responsive riboswitch system used for MatK expression demonstrates the importance of controlled induction .

  • Developmental timing: Phenotypic and molecular analyses at the cotyledon stage can capture early developmental effects of photosystem protein manipulation .

The observation that spectinomycin treatment exacerbates phenotypes in MatK-overexpressing plants highlights the importance of controlling translation inhibition when studying photosynthetic proteins .

What vector design strategies optimize expression of recombinant Cuscuta photosystem proteins?

Effective vector design for recombinant Cuscuta photosystem protein expression requires multiple considerations:

  • Codon optimization: Creating a synthetic gene with altered nucleotide sequence while maintaining amino acid identity (as demonstrated with the 72% nucleotide similarity MatK construct) prevents undesirable homologous recombination with endogenous sequences .

  • Promoter selection: The tobacco plastid rRNA operon promoter (Prrn) has proven effective for transplastomic expression .

  • Expression control elements: A theophylline-responsive riboswitch provides translational control, allowing modulation of potentially toxic protein expression .

  • Detection tags: C-terminal epitope tagging (triple HA tag) enables immunological detection without interfering with function .

  • Targeting sequences: For chloroplast transformation, flanking sequences allowing homologous recombination into neutral intergenic regions ensure stable integration .

  • Selection markers: The chimeric spectinomycin resistance gene (aadA) facilitates selection of transplastomic plants .

The vector construction approach using overlap PCR with careful design of restriction sites facilitates efficient assembly of these complex expression constructs .

What purification protocols maximize yield and activity of recombinant photosystem proteins?

Purification of functional photosystem proteins requires protocols that preserve structure and activity:

  • Tissue preparation: Total leaf protein extraction under denaturing conditions has been successful for immunological detection of plastid proteins .

  • Membrane protein solubilization: Detergent screening is critical, with mild non-ionic detergents often preferable for maintaining native conformation.

  • Affinity purification: HA-tagged proteins can be efficiently purified using anti-HA antibody affinity chromatography, as demonstrated for MatK:HA detection .

  • Size exclusion chromatography: This helps separate monomeric proteins from aggregates or complexes.

  • Activity preservation: Including protease inhibitors and conducting purification at low temperatures helps maintain protein integrity.

The immunological detection approach using anti-HA antibodies against denatured proteins separated on 12% polyacrylamide gels provides a validated method for monitoring purification progress .

What analytical techniques are most effective for characterizing recombinant Cuscuta proteins?

Multiple analytical approaches provide complementary information about recombinant Cuscuta proteins:

  • Immunoblot analysis: Detection with specific antibodies (e.g., anti-HA for tagged proteins) provides sensitive protein quantification .

  • RNA co-immunoprecipitation: This identifies RNA binding partners of proteins like MatK that interact with specific transcripts .

  • RNA gel blot hybridization: This technique effectively detects spliced and unspliced RNA species, allowing assessment of splicing factor activity .

  • Mass spectrometry: This identifies post-translational modifications and confirms protein identity.

  • High-performance liquid chromatography (HPLC): This provides precise quantification of proteins and associated compounds.

For flavonoid analysis in Cuscuta species, validated HPLC methods have been developed with the following performance characteristics:

CompoundLinearity (r²)Intra-day Precision (RSD%)Inter-day Precision (RSD%)LOD (μg/ml)LOQ (μg/ml)Recovery (%)
Rutin>0.9991.33.41.738.1990.3
Hyperoside>0.9991.52.80.094.1997.4
Isorhamnetin>0.9991.33.32.096.398.7
Kaempferol>0.9991.72.90.180.5690.0

These validated analytical parameters demonstrate the precision and sensitivity achievable for Cuscuta-derived compounds .

How can functional assays be adapted to assess recombinant photosystem protein activity?

Functional assessment of recombinant photosystem proteins requires specialized assays:

  • RNA splicing assays: For proteins with RNA processing functions like MatK, analyzing the accumulation of spliced versus unspliced transcripts provides functional evidence .

  • Chloroplast development assessment: Phenotypic analysis of transplastomic plants, particularly focusing on cotyledon bleaching or variegation, reveals effects on chloroplast development .

  • Electron transport measurements: Oxygen evolution and chlorophyll fluorescence provide quantitative measures of photosystem function.

  • Protein-protein interaction assays: Co-immunoprecipitation identifies interaction partners essential for function.

  • In vitro reconstitution: Assembly of purified components into functional complexes demonstrates preserved activity.

The approach of comparing RNA accumulation patterns between wild-type, transplastomic, and phenocopy plants (created by mild spectinomycin treatment) effectively distinguishes primary from secondary effects of protein manipulation .

How should researchers interpret evolutionary rate differences in photosystem genes from parasitic plants?

Interpreting evolutionary rate differences requires careful consideration of multiple factors:

  • Distinguish between non-synonymous and synonymous substitutions: Higher rates in parasitic plants like Cuscuta have been observed for both plastid ribosomal RNA (rrn16) and protein-coding genes (matK, rbcL) .

  • Consider lineage-specific patterns: While most holoparasitic plants show increased substitution rates, exceptions exist (e.g., Mitrastemonaceae show no increased rates in plastid genes despite increased rates in nuclear 18S) .

  • Evaluate functional implications: Accelerated evolution may indicate relaxed selection, positive selection, or both.

  • Analyze patterns across multiple genes: Compare rates in photosynthetic versus non-photosynthetic genes to distinguish genome-wide from function-specific effects.

Plant GroupPlastid rRNA rrn16Plastid matKPlastid rbcLNuclear 18S
Most holoparasitesHigherHigherHigherHigher
Cuscuta speciesHigherHigherHigherHigher
MitrastemonaceaeNo increaseNo increaseNo increaseHigher

This pattern of rate variation across genes and lineages suggests complex evolutionary dynamics in parasitic plants .

What statistical approaches are most appropriate for analyzing variability in recombinant protein expression?

Statistical analysis of recombinant protein expression requires approaches that account for biological and technical variability:

When analyzing gene expression data from microarrays, appropriate normalization and statistical testing are essential for identifying differentially expressed genes .

How can researchers distinguish between primary effects and secondary consequences when studying recombinant photosystem proteins?

Distinguishing primary from secondary effects requires strategic experimental design:

  • Use of appropriate controls: Wild-type plants, plants containing the selectable marker but no transgene (pRB70 control lines), and phenocopies generated by mild antibiotic treatment provide essential comparison groups .

  • Time-course analysis: Early effects are more likely to be primary, while later effects may represent secondary consequences.

  • Dose-response relationships: Using inducible systems like the theophylline-responsive riboswitch allows titration of protein expression to identify threshold effects .

  • Combined analysis of multiple parameters: Integrating data on protein levels, RNA processing, and phenotypic effects provides a more complete picture.

  • Genetic approaches: Rescue experiments or suppressor screens can confirm causal relationships.

The observation that RNA levels in MatK-overexpressing plants were similar to controls under normal conditions, but dramatically altered under spectinomycin treatment, illustrates how combined perturbations can reveal effects not evident from single manipulations .

What bioinformatic tools best support research on recombinant Cuscuta photosystem proteins?

Bioinformatic analysis of Cuscuta photosystem proteins benefits from several specialized tools:

  • Sequence analysis tools:

    • Multiple sequence alignment programs for comparing sequences across parasitic and non-parasitic relatives

    • Programs for detecting selection (dN/dS analysis) to identify sites under positive or relaxed selection

    • Codon optimization algorithms for designing synthetic genes with altered nucleotide sequence while preserving amino acid identity

  • Structural prediction tools:

    • Homology modeling software to predict three-dimensional structures

    • Tools for identifying conserved domains and functional motifs

    • Molecular dynamics simulation programs to explore conformational dynamics

  • Evolutionary analysis software:

    • Bayesian and maximum likelihood approaches for phylogenetic analysis

    • Molecular clock models including uncorrelated lognormal (UCLN) and random local clock (RLC) to analyze rate changes

    • Programs for detecting horizontal gene transfer events

  • Expression data analysis:

    • Software for analyzing microarray data to identify co-regulated genes

    • Tools for RNA-Seq analysis to quantify transcript abundance and identify splice variants

These bioinformatic approaches complement experimental studies, providing context for interpreting functional and evolutionary patterns in Cuscuta photosystem proteins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.