Recombinant Cuscuta exaltata Plastid envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
cemA; Plastid envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Cuscuta exaltata (Tall dodder)
Target Names
cemA
Target Protein Sequence
MTKKKAFTPILYLSFIVFLPWWIYFSFNKCLGSWITNWWNTRESEIFLNDLQEKSILEKL IELEEFLFVDEILKKNSETHPQEFHTGIHKEAIQFIKIQNESYIHMILRLSTNLICVVII SGFYIWRNETLVILNSWSREFLYNLSDTVKVFSILLLTDLCIGFHSPHGWELMIGSIYQD FGFVQNDRIISGLVSTFPVILDTILKYWIFRYLNRVSPSLVVIYHSIND
Uniprot No.

Target Background

Function

This protein may be involved in proton extrusion and indirectly facilitates efficient inorganic carbon uptake into plastids.

Protein Families
Cema family
Subcellular Location
Plastid membrane; Multi-pass membrane protein.

Q&A

What is Cuscuta exaltata and why is it significant for plastid research?

Cuscuta exaltata, commonly known as Tall dodder, is a parasitic vine found in Florida and Texas. It represents an excellent model system for studying plastid evolution in parasitic plants due to its ectoparasitic nature, attaching to hosts via specialized structures called haustoria. Unlike most plants, C. exaltata has limited photosynthetic capacity, requiring it to obtain nutrients from host plants . The significance of C. exaltata in plastid research stems from its evolutionary position, showing intermediate levels of plastome reduction compared to other Cuscuta species. While some Cuscuta species have extensively reduced plastomes with loss of photosynthesis-related genes, C. exaltata maintains certain plastid functions, providing insights into the gradual loss of photosynthetic machinery during parasitic evolution .

What are the general characteristics of plastid envelope membrane proteins in parasitic plants?

Plastid envelope membrane proteins in parasitic plants often show modifications reflecting their reduced photosynthetic capacity. In Cuscuta species, these proteins typically maintain structural roles while photosynthesis-related functions may be reduced or lost. Research suggests that despite photosynthesis not being the main process in Cuscuta plastids, proteins like cemA remain conserved, indicating alternative or essential non-photosynthetic functions . Plastid envelope proteins in parasitic plants may be involved in metabolite transport, signaling between the parasite and host, and maintenance of basic plastid functions even in the absence of photosynthesis.

How does the cemA gene differ between Cuscuta species and photosynthetic relatives?

Comparative genomic analyses reveal notable differences in cemA between Cuscuta species and their photosynthetic relatives in Convolvulaceae (such as Ipomoea species). While photosynthetic plants maintain highly conserved cemA sequences, Cuscuta species show varying degrees of sequence modifications correlating with their level of parasitism. In C. exaltata, which retains some photosynthetic capacity, cemA shows fewer modifications compared to more derived holoparasitic Cuscuta species . The plastome organization around cemA also differs, with Cuscuta species having contracted inverted repeat regions and restructured gene arrangements compared to photosynthetic relatives . This reflects the ongoing plastome reduction process in parasitic plants.

What methodological approaches are most effective for studying cemA protein function in parasitic plants?

For comprehensive analysis of cemA function in parasitic plants like Cuscuta exaltata, researchers should implement multiple complementary approaches:

  • Recombinant protein studies: Expression and purification of recombinant cemA allows in vitro functional characterization, including membrane integration assays and transport studies .

  • Localization studies: Immunofluorescence microscopy using anti-cemA antibodies can determine precise subcellular localization in different tissues and developmental stages, similar to approaches used for other plastid proteins in Cuscuta .

  • Comparative genomics: Analysis of cemA sequence conservation across Cuscuta species with different degrees of parasitism provides evolutionary insights .

  • Protein-protein interaction studies: Co-immunoprecipitation, yeast two-hybrid, or proximity labeling techniques can identify interaction partners, illuminating functional networks.

  • RNA-seq analysis: Transcriptomic approaches help determine expression patterns during different developmental stages, particularly during host attachment.

For high-resolution structural studies, purified recombinant cemA protein can be analyzed using techniques such as X-ray crystallography or cryo-electron microscopy, though membrane proteins present significant technical challenges.

How has the plastid genome organization around cemA evolved in Cuscuta relative to photosynthetic plants?

The plastid genome of Cuscuta species has undergone significant structural rearrangements compared to photosynthetic relatives. In photosynthetic plants, cemA typically resides in the Large Single Copy (LSC) region. Comparative analysis of Cuscuta species shows that while gene content has been reduced, the relative position of cemA has been maintained in most species, suggesting functional constraints .

In C. exaltata, the LSC region is shorter than in Ipomoea species but larger than in more derived parasitic Cuscuta species like C. gronovii and C. obtusiflora . This intermediate state reflects C. exaltata's evolutionary position. The retention of cemA despite plastome reduction indicates selective pressure to maintain this gene, even as other photosynthesis-related genes have been lost.

Table 1: Comparison of plastome regions among Convolvulaceae species

SpeciesTotal plastome (kb)LSC region (kb)SSC region (kb)IR region (kb)
Ipomoea species161-162~89~12~30
Cuscuta cretica~160>8932.5<20
Cuscuta exaltata125-130<89~15<15
Cuscuta gronovii85-90<<89<15<15

Data compiled from available literature on Convolvulaceae plastomes .

What evidence supports functional retention of cemA in Cuscuta exaltata despite plastome reduction?

Despite significant plastome reduction in Cuscuta species, several lines of evidence support the functional retention of cemA in C. exaltata:

  • Sequence conservation: The cemA sequence in C. exaltata maintains key functional domains without accumulating nonsense mutations or frameshifts that would indicate pseudogenization .

  • Transcriptional evidence: Studies in related Cuscuta species demonstrate that retained plastid genes are actively transcribed, suggesting continued expression of cemA .

  • Protein detection: The ability to produce recombinant cemA protein indicates the gene encodes a full-length functional protein .

  • Selective pressure: Comparative analysis suggests positive selection maintains cemA while other photosynthesis-related genes have been lost or pseudogenized, indicating non-photosynthetic functions .

  • Functional analogy: Research on ribosomal proteins in C. europaea demonstrates that some plastid functions remain intact despite extensive gene loss, suggesting similar conservation of essential membrane proteins like cemA .

This evidence collectively indicates that cemA likely performs essential functions beyond photosynthesis in the parasitic lifestyle of Cuscuta exaltata.

How might cemA be involved in host-parasite interactions in Cuscuta exaltata?

The potential role of cemA in host-parasite interactions remains largely unexplored, but several hypotheses can be proposed based on current knowledge:

  • Metabolite transport: cemA might facilitate the transport of specific compounds between the parasite and host plants through modified transport functions.

  • Signaling pathways: Similar to THF1 protein in Cuscuta europaea, which localizes to both plastid membranes and plasma membranes , cemA might participate in signaling pathways that coordinate parasite development with host attachment.

  • Haustorium development: Plastid proteins in Cuscuta have been implicated in haustorium development. For example, THF1 shows high accumulation in tissues actively involved in forming parasitic connections , suggesting cemA might have similar developmental roles.

  • Adaptation to host metabolism: cemA might help Cuscuta plastids process or utilize metabolites obtained from the host, compensating for reduced photosynthetic capacity.

Research using localization studies during haustorial development, combined with protein interaction analyses, could help elucidate cemA's specific roles in host-parasite interactions.

What are the optimal protocols for recombinant cemA protein production and purification?

For successful production of functional recombinant Cuscuta exaltata cemA protein, researchers should consider the following optimized protocol:

  • Expression system selection: As cemA is a membrane protein, specialized expression systems designed for membrane proteins should be employed. E. coli strains like C41(DE3) or C43(DE3), designed for membrane protein expression, often yield better results than standard strains.

  • Vector design: The complete coding sequence (amino acids 1-229) should be cloned into an expression vector with an appropriate fusion tag (His, GST, or MBP) to facilitate purification. For structural studies, a cleavable tag is preferable.

  • Expression conditions: Low-temperature induction (16-18°C) with reduced inducer concentration often improves membrane protein folding and reduces inclusion body formation.

  • Membrane extraction: Gentle detergent solubilization using non-ionic detergents like DDM (n-dodecyl β-D-maltoside) or LMNG (lauryl maltose neopentyl glycol) is typically effective for membrane protein extraction.

  • Purification strategy: A two-step purification approach using affinity chromatography followed by size exclusion chromatography typically yields high purity protein suitable for functional and structural studies.

For functional studies, reconstitution into liposomes or nanodiscs may be necessary to evaluate membrane protein activity in a native-like lipid environment.

What assays can determine the functional activity of recombinant cemA protein?

To assess the functional activity of recombinant cemA protein from Cuscuta exaltata, researchers should consider the following assays:

  • Liposome reconstitution and transport assays: Purified cemA can be reconstituted into liposomes to measure potential transport activities using radioactively labeled substrates or fluorescent probes.

  • Electrophysiological measurements: Techniques such as patch-clamp on proteoliposomes or planar lipid bilayers can detect ion channel or transporter activity of reconstituted cemA.

  • Binding assays: Surface plasmon resonance (SPR) or microscale thermophoresis (MST) can measure binding of potential substrates or interaction partners to purified cemA.

  • Structural integrity assessment: Circular dichroism (CD) spectroscopy can verify proper folding of the recombinant protein, essential for functional studies.

  • In vivo complementation: Expression of C. exaltata cemA in photosynthetic organisms with cemA mutations could assess functional conservation across species.

When interpreting results, researchers should consider that cemA function in parasitic plants might differ significantly from its role in photosynthetic organisms, necessitating broader functional screening approaches.

How can researchers effectively analyze cemA transcript expression across different Cuscuta developmental stages?

To effectively analyze cemA transcript expression across different developmental stages of Cuscuta exaltata, researchers should implement a comprehensive approach:

  • Sample collection strategy: Collect tissue samples representing key developmental stages:

    • Pre-germination seeds

    • Young seedlings before host attachment

    • Searching/coiling stage

    • Early haustorium formation

    • Mature parasitic connection

    • Flowering stage

  • RNA extraction optimization: Due to high levels of polysaccharides and secondary metabolites in Cuscuta tissues, modified CTAB-based extraction protocols with additional purification steps yield better quality RNA.

  • Transcript quantification methods:

    • RT-qPCR using primers specific to cemA, with appropriate reference genes for normalization

    • RNA-Seq for genome-wide expression context

    • In situ hybridization to determine tissue-specific expression patterns, particularly during haustorium development

  • Data analysis considerations: When analyzing expression data, compare cemA expression patterns with those of other plastid genes to distinguish between general plastid regulatory changes and cemA-specific regulation. Studies in related Cuscuta species have demonstrated that plastid genes can remain transcriptionally active even when their function has changed in the parasitic context .

What comparative approaches could reveal adaptive changes in cemA across different parasitic plant lineages?

Future research into adaptive changes in cemA across parasitic plant lineages should employ multifaceted comparative approaches:

  • Phylogenetic analysis: Comprehensive sampling of cemA sequences from multiple Cuscuta species representing different degrees of parasitism, compared with photosynthetic relatives, can reveal patterns of selection and convergent evolution. This should include both partially photosynthetic species like C. exaltata and holoparasitic species.

  • Structural biology: Comparative modeling of cemA proteins from different parasitic lineages can identify conserved structural features versus lineage-specific adaptations. Research on other plastid proteins has shown that even with sequence divergence, key structural elements may be conserved .

  • Functional comparison: Heterologous expression of cemA variants from different parasitic lineages in model systems can reveal functional differences. This approach has been successful with other plastid proteins from parasitic plants.

  • Plastome context analysis: Examining the genomic context of cemA across species can reveal how plastome reduction affects gene arrangement and potential regulatory elements. Studies have shown significant variation in plastome organization among Cuscuta species, with varying losses in the LSC, SSC, and IR regions .

  • Transcriptome coordination: Analyzing co-expression networks across species can reveal how cemA regulation has evolved in concert with other genes during the transition to parasitism.

How might CRISPR/Cas9 technology advance our understanding of cemA function in parasitic plants?

CRISPR/Cas9 technology offers promising approaches to advance our understanding of cemA function in parasitic plants, despite technical challenges:

  • Technical considerations for Cuscuta transformation:

    • Developing reliable transformation protocols for Cuscuta species

    • Optimizing plastid-targeted CRISPR systems, as nuclear transformation may be more feasible than direct plastid transformation

    • Establishing tissue culture regeneration protocols for edited parasitic plants

  • Potential experimental approaches:

    • Creating cemA knockouts or specific domain mutations to assess functional impacts on parasite development and host interaction

    • Introducing reporter fusions to study cemA localization and expression patterns in vivo

    • Performing base editing to study specific amino acid contributions to cemA function

  • Alternative approaches while transformation protocols develop:

    • Virus-induced gene silencing (VIGS) for transient knockdown of nuclear-encoded factors that interact with cemA

    • Host-induced gene silencing approaches targeting cemA transcripts

    • CRISPR editing of cemA in model photosynthetic plants followed by functional complementation with Cuscuta cemA variants

The application of these emerging technologies to cemA research would significantly advance our understanding of plastid protein evolution in parasitic plants.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.