Recombinant Cuscuta gronovii Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-320
Protein Length
Full Length of Mature Protein
Species
Cuscuta gronovii (Common dodder)
Target Names
petA
Target Protein Sequence
YPLFAQQGYENPREATGRIVCANCHLANKPVNIEVPQAILPDTVFEAVVQIPYDLQLKQV LSNGKKGGLNVGAVLILPEGFELAPPDRISPELKEKIGNLYFQSYRPNIKNIFVVGPVPG QKYTKITFPILSPNPANNRRAHFLKYPIYVGGNRGRGQIYPDGSKSNNTVFNATASGRVK KIIRNQKGGYEIIINDGSDSNEVVNLLPPGLEPLVSEGESIKLDQPLTSNPNVGGFGQDV AEVVLQDPSRVQVLLFFFASIILAQIFLVLKKKQFEKVQLTKINL
Uniprot No.

Target Background

Function
Recombinant Cuscuta gronovii Apocytochrome f (petA) is a component of the cytochrome b6-f complex. This complex facilitates electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome f family
Subcellular Location
Plastid thylakoid membrane; Single-pass membrane protein.

Q&A

What is Cuscuta gronovii and why is it significant in research?

Cuscuta gronovii, commonly known as common dodder, swamp dodder, or love dodder, is a parasitic annual vine belonging to the Convolvulaceae family. It is significant in research due to its obligate parasitic nature and unique biological characteristics. The plant appears as an orange-yellow vine that can grow up to one meter or more in length, entangling itself around host plants .

This species is native to most of the United States (except Utah, Nevada, California, Washington, Alaska, and Hawaii) and most provinces of Canada (except British Columbia, Yukon, Northwest Territories, and Nunavut). It has also naturalized in several European countries including France, Germany, Luxembourg, the Netherlands, and Italy .

Cuscuta gronovii is particularly valuable for studying plant parasitism mechanisms, haustorium development, and horizontal gene transfer events in parasitic relationships.

What are the optimal storage conditions for Recombinant Cuscuta gronovii Apocytochrome f?

The recommended storage conditions for Recombinant Cuscuta gronovii Apocytochrome f are:

FormStorage TemperatureShelf LifeNotes
Liquid-20°C/-80°C~6 monthsAliquoting is necessary for multiple use
Lyophilized powder-20°C/-80°C~12 monthsStore upon receipt

For working aliquots, storage at 4°C for up to one week is recommended. Repeated freeze-thaw cycles should be avoided as they can compromise protein integrity and activity .

When reconstituting the lyophilized protein, it is advised to briefly centrifuge the vial prior to opening to bring contents to the bottom. The protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol (final concentration) for long-term storage at -20°C/-80°C .

What buffer conditions are recommended for working with this recombinant protein?

The recombinant protein is typically provided in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0 . This buffering system helps maintain protein stability during storage and reconstitution.

When designing experiments, researchers should consider that:

  • The buffer components (particularly trehalose) may affect certain assay types

  • For applications requiring different buffer conditions, a buffer exchange procedure may be necessary

  • When diluting the protein for experimental use, the same buffer composition should ideally be maintained to prevent precipitation or loss of activity

For specialized applications, pilot experiments to determine optimal buffer conditions for your specific experimental system are recommended.

How can Recombinant Cuscuta gronovii Apocytochrome f be used in structural biology research?

Recombinant Cuscuta gronovii Apocytochrome f, with its N-terminal 10xHis-tag, is well-suited for structural biology applications through the following methodological approaches:

  • X-ray Crystallography: The His-tagged protein can be purified using immobilized metal affinity chromatography (IMAC) to near homogeneity (>90% purity as determined by SDS-PAGE ), which is crucial for crystallization trials. The presence of the His-tag facilitates oriented immobilization on Ni-NTA or similar matrices for crystal formation attempts.

  • Cryo-Electron Microscopy (Cryo-EM): The purified protein can be prepared for grid preparation and imaging using single-particle analysis techniques. The relatively large size of the mature protein (36-320 amino acids) makes it suitable for cryo-EM studies.

  • Nuclear Magnetic Resonance (NMR) Spectroscopy: For solution-state structural analysis, the recombinant protein can be expressed in isotopically labeled media (15N, 13C) in the E. coli expression system to enable multidimensional NMR experiments.

Research strategy recommendation: Compare the structural features of Apocytochrome f from parasitic Cuscuta gronovii with those from photosynthetically active plants to identify potential structural adaptations related to its parasitic lifestyle.

What methods can be used to study interactions between Apocytochrome f and other proteins in the electron transport chain?

Several complementary methods can be employed to investigate protein-protein interactions involving Recombinant Cuscuta gronovii Apocytochrome f:

  • Co-immunoprecipitation (Co-IP): Utilizing the His-tag for pull-down experiments followed by mass spectrometry to identify interacting partners.

  • Surface Plasmon Resonance (SPR): The His-tagged protein can be immobilized on a Ni-NTA sensor chip to quantitatively measure binding kinetics with potential interaction partners.

  • Biolayer Interferometry (BLI): Similar to SPR but using optical interference patterns to detect binding events in real-time.

  • Yeast Two-Hybrid (Y2H) Assays: Though challenging with membrane-associated proteins, modified Y2H systems can be used to screen for potential interactors.

  • Proximity-Based Labeling: Techniques such as BioID or APEX2, where the protein of interest is fused to a promiscuous biotin ligase to identify proximal proteins in vivo.

When studying electron transport chain components, researchers should consider reconstructing partial or complete electron transport chain components in liposomes or nanodiscs to maintain native-like membrane environments for interaction studies.

How does Apocytochrome f from Cuscuta gronovii compare with homologous proteins from other plant species?

Comparative analysis reveals several interesting aspects of Cuscuta gronovii Apocytochrome f relative to other plant species:

Species TypeSequence IdentityKey DifferencesFunctional Implications
Photosynthetic non-parasitic plantsModerate to highConserved electron transfer domainsStandard photosynthetic function
Other parasitic plantsVariablePotential loss of certain functional domainsReduced photosynthetic capacity
Cuscuta species from different subgeneraHigh within genusSubgenus-specific variationsReflect evolutionary history of parasitism

The protein sequence analysis must be considered in the context of Cuscuta's parasitic lifestyle and reduced photosynthetic capacity. While the petA gene is retained in Cuscuta gronovii, the functionality of the resulting protein in electron transport may be altered compared to fully photosynthetic plants.

Research has shown that parasitic plants like Cuscuta have experienced various degrees of gene loss or modification in their plastid genomes related to photosynthesis functions, while maintaining genes essential for other cellular processes. A detailed phylogenetic analysis would help determine whether the retained Apocytochrome f in Cuscuta gronovii represents a functional protein or a gene in the process of pseudogenization.

What does the presence of petA gene in Cuscuta gronovii reveal about the evolution of parasitism in this genus?

The presence of the petA gene encoding Apocytochrome f in Cuscuta gronovii provides significant insights into the evolutionary trajectory of parasitism in this genus:

  • Evolutionary Timeline: The retention of photosynthesis-related genes like petA suggests that parasitism in Cuscuta is relatively recent in evolutionary terms compared to holoparasites that have lost most photosynthetic apparatus genes.

  • Selective Gene Loss: The fact that petA is retained while other genes might be lost indicates differential selective pressures on components of the photosynthetic machinery during the transition to parasitism.

  • Functional Repurposing: The protein may have evolved secondary functions beyond photosynthesis that remain beneficial to the parasitic lifestyle, explaining its retention despite reduced photosynthetic capacity.

Research examining horizontal gene transfer (HGT) in Cuscuta species has found significant HGT events in nuclear genomes, but surprisingly few in mitochondrial genomes . This suggests complex evolutionary dynamics where certain genetic elements are more prone to transfer or retention than others.

The retention of petA should be considered alongside findings that Cuscuta species can fine-tune gene expression during host infection , indicating sophisticated regulatory mechanisms that may influence how historical photosynthetic genes are utilized in contemporary parasitic contexts.

How can Recombinant Cuscuta gronovii Apocytochrome f be used to study haustorium development in parasitic plants?

Recombinant Cuscuta gronovii Apocytochrome f can serve as a molecular tool to investigate haustorium development through these methodological approaches:

  • Protein Localization Studies: Using antibodies against the recombinant protein to track its distribution during haustorium formation and host attachment, which could reveal whether this historically photosynthetic protein has been repurposed for parasitic functions.

  • Protein-Protein Interaction Networks: Identifying interacting partners of Apocytochrome f during different stages of haustorium development to understand potential novel functions in the parasitic context.

  • Transgenic Approaches: The recently developed transformation protocol for Cuscuta reflexa could be adapted for C. gronovii to generate transgenic lines with modified petA expression, allowing for functional analysis of this protein in haustorium development.

Haustoria are specialized intrusive organs that allow parasitic plants to acquire water and nutrients from their hosts . Research indicates that haustorium development in Cuscuta involves complex signaling triggered by light cues (particularly far-red to red light ratios) and physical contact with host plants . Investigating whether components of the photosynthetic apparatus like Apocytochrome f have been co-opted into these developmental pathways could provide critical insights into the molecular mechanisms of parasitism evolution.

What methodologies can be employed to investigate the potential role of Apocytochrome f in the host-parasite interaction of Cuscuta gronovii?

Several sophisticated methodologies can be employed to investigate potential roles of Apocytochrome f in host-parasite interactions:

  • Transcriptome Analysis: Comparing expression patterns of petA and related genes in parasitic tissues at different stages of host attachment and in response to different host species.

  • RNAi or CRISPR-Based Gene Silencing/Editing: Using transformation technologies to modify petA expression and observe effects on parasite virulence and host range.

  • Proteomics Approaches: Using techniques like LC-MS/MS to identify changes in protein abundance and post-translational modifications of Apocytochrome f during parasitism.

  • Immunohistochemistry: Localizing the protein within haustorium tissues and at the host-parasite interface using antibodies against the recombinant protein.

  • Host Response Assays: Introducing purified recombinant protein to potential host plants to determine if it triggers defense responses, potentially indicating recognition by host immune systems.

Research has shown that Cuscuta campestris can adjust its gene expression in response to different host species, particularly regarding cell wall degradation genes when interacting with hosts that induce cell wall fortification genes . Similar adaptive responses might involve historically photosynthetic proteins that have gained new functions in the parasitic context.

What strategies can be used to modify Recombinant Cuscuta gronovii Apocytochrome f for enhanced stability or novel functions?

Several protein engineering approaches can be employed to modify Recombinant Cuscuta gronovii Apocytochrome f:

  • Site-Directed Mutagenesis: Targeted modification of specific amino acids to enhance stability, alter cofactor binding, or modify interaction surfaces. The amino acid sequence provided in the search results can serve as the template for designing mutation sites.

  • Domain Swapping: Replacing domains with homologous regions from other species to create chimeric proteins with hybrid properties or to investigate domain-specific functions.

  • Disulfide Engineering: Introduction of strategic disulfide bonds to increase thermostability without compromising function, particularly relevant given the presence of cysteine residues in the sequence (note the CANCHLAN motif which likely represents a metal-binding site).

  • PEGylation or Fusion Protein Approaches: Addition of polyethylene glycol chains or fusion partners (beyond the existing His-tag) to improve solubility, reduce immunogenicity, or enhance half-life for certain applications.

  • Directed Evolution: Employing error-prone PCR or DNA shuffling to generate variant libraries followed by selection for desired properties such as increased stability or altered substrate specificity.

For researchers specifically interested in functional studies, focus on the highly conserved regions identified through multiple sequence alignments of cytochrome f proteins across species could reveal critical residues for electron transfer functions.

How can isotope labeling of Recombinant Cuscuta gronovii Apocytochrome f enhance structural and functional studies?

Isotope labeling of Recombinant Cuscuta gronovii Apocytochrome f offers powerful advantages for structural and functional investigations:

  • Uniform 15N/13C Labeling for NMR Studies:

    • Methodology: Express the protein in E. coli grown in minimal media containing 15NH4Cl as the sole nitrogen source and 13C-glucose as the carbon source

    • Applications: Enables multidimensional NMR experiments for complete structure determination and dynamics studies

    • Advantage: Provides atomic-level information about protein structure and conformational changes

  • Selective Amino Acid Labeling:

    • Methodology: Incorporation of specific isotopically labeled amino acids in an otherwise unlabeled protein

    • Applications: Simplifies NMR spectra and allows focus on specific regions of interest

    • Advantage: Particularly useful for studying metal coordination sites or active centers

  • Deuteration:

    • Methodology: Expression in D2O-based media to replace hydrogen atoms with deuterium

    • Applications: Reduces signal relaxation in NMR experiments and improves neutron scattering contrast

    • Advantage: Essential for studying larger proteins or complexes by NMR

  • Site-Specific Labeling for FRET or EPR Studies:

    • Methodology: Introduction of unnatural amino acids at specific positions for subsequent labeling with fluorophores or spin labels

    • Applications: Enables distance measurements and conformational change monitoring

    • Advantage: Provides information about protein dynamics during function

These approaches are particularly valuable for investigating the potential changes in structure and function of Apocytochrome f in the context of Cuscuta's parasitic lifestyle compared to photosynthetic plants.

What are the common challenges in expressing and purifying Recombinant Cuscuta gronovii Apocytochrome f, and how can they be addressed?

Researchers commonly encounter several challenges when working with Recombinant Cuscuta gronovii Apocytochrome f:

ChallengePotential CausesTroubleshooting Approaches
Low expression yieldCodon bias in E. coli expression systemUse codon-optimized gene sequence or specialized E. coli strains (Rosetta, CodonPlus)
Protein insolubilityMembrane protein characteristics, improper foldingLower induction temperature (16-20°C), add solubility tags, use specialized detergents
Cofactor incorporation issuesHeme coordination difficultiesSupplement growth media with δ-aminolevulinic acid, use specific E. coli strains for heme proteins
Proteolytic degradationSensitivity to host proteasesAdd protease inhibitors, use protease-deficient strains, optimize purification speed
Protein aggregationHydrophobic regions, improper disulfide formationInclude mild detergents, add reducing agents, optimize buffer conditions

For protein purification, a systematic approach is recommended:

  • Begin with IMAC purification exploiting the His-tag

  • Follow with size exclusion chromatography to remove aggregates

  • Assess protein quality using multiple methods (SDS-PAGE, Western blot, dynamic light scattering)

  • Confirm structural integrity via circular dichroism or limited proteolysis

The expression of Apocytochrome f rather than mature Cytochrome f (which contains covalently bound heme) may help avoid some cofactor-related issues but limits functional studies requiring the intact holoprotein.

How can researchers address data inconsistencies when comparing results from studies using Recombinant Cuscuta gronovii Apocytochrome f with native protein?

When confronting discrepancies between results obtained with recombinant versus native Apocytochrome f, researchers should consider these methodological approaches:

  • Protein Characterization Comparisons:

    • Conduct parallel structural analyses (CD spectroscopy, thermal stability assays) of both recombinant and native proteins

    • Compare post-translational modifications using mass spectrometry

    • Assess cofactor incorporation differences that might affect function

  • Expression System Considerations:

    • Evaluate the impact of the E. coli expression system versus plant-based systems

    • Consider the influence of the His-tag on protein behavior

    • Explore alternative expression systems (yeast, insect cells) that might better recapitulate native conditions

  • Experimental Design Adjustments:

    • Include appropriate controls to account for system-specific effects

    • Validate key findings using both protein sources when possible

    • Develop correction factors based on systematic comparisons of activity or binding parameters

  • Data Normalization Strategies:

    • When direct comparisons are necessary, normalize data based on active protein concentration rather than total protein

    • Consider developing activity-based normalization methods specific to the protein's function

    • Report both absolute and normalized values to enhance transparency

The N-terminal His-tag present in the recombinant protein may influence protein behavior, particularly for a protein that naturally associates with membrane components. Tag removal experiments using specific proteases might help determine the extent of this influence.

How might the study of Recombinant Cuscuta gronovii Apocytochrome f contribute to understanding the kinetochore adaptations in holocentric Cuscuta species?

While Apocytochrome f is primarily associated with photosynthetic functions, studying this protein in the context of holocentric Cuscuta species could provide unexpected insights into cellular adaptations:

  • Evolutionary Repurposing Hypothesis: Research on holocentric Cuscuta species has revealed significant modifications to conventional kinetochore assembly . The retention of historically photosynthetic proteins like Apocytochrome f in parasitic species raises the possibility that some may have evolved secondary functions in cellular processes beyond photosynthesis.

  • Protein Localization Studies: Using antibodies against recombinant Apocytochrome f to investigate its cellular distribution in dividing cells of holocentric versus monocentric Cuscuta species could reveal potential non-canonical roles.

  • Interaction Network Analysis: Comparing protein interaction partners between monocentric and holocentric species might uncover unexpected associations with chromosomal proteins or structures.

Recent research has shown that holocentric Cuscuta species exhibit "disruption of the standard kinetochore" with the conventional SAC (Spindle Assembly Checkpoint) being abolished . This dramatic cellular adaptation represents a major evolutionary change that may have involved recruitment of proteins from various cellular pathways.

A particularly intriguing research direction would involve investigating whether proteins historically involved in photosynthesis might have been co-opted into novel functions during the evolution of holocentricity, similar to how certain genes have gained new functions during the evolution of parasitism.

What potential applications exist for Recombinant Cuscuta gronovii Apocytochrome f in synthetic biology and bioenergy research?

Recombinant Cuscuta gronovii Apocytochrome f presents several promising applications in advanced synthetic biology and bioenergy research:

  • Electron Transport Chain Engineering:

    • The protein could serve as a building block for creating synthetic electron transport chains with novel properties

    • Potential for designing artificial photosynthetic systems with modified electron flow characteristics

    • Applications in microbial fuel cells or bioelectrochemical systems

  • Comparative Studies for Photosynthesis Optimization:

    • Analysis of Apocytochrome f from parasitic plants could reveal evolutionary adaptations that might inform efforts to enhance photosynthetic efficiency

    • Identification of key residues that influence electron transfer rates or protein stability under various conditions

    • Development of more robust photosynthetic components for synthetic systems

  • Biosensor Development:

    • The electron-carrying properties of cytochrome proteins make them candidates for redox-based biosensors

    • Potential applications in environmental monitoring or metabolic engineering

    • Development of hybrid devices incorporating biological electron transfer components with electronic systems

  • Biohybrid Energy Systems:

    • Integration with nanomaterials to create biohybrid systems for light harvesting and energy conversion

    • Exploration of direct electron transfer between biological components and electrodes

    • Development of bio-inspired artificial photosynthetic systems for sustainable energy production

The study of electron transfer proteins from parasitic plants like Cuscuta gronovii, which have evolved under different selective pressures than typical photosynthetic plants, may provide unique insights for designing more efficient or robust artificial systems.

What are the key considerations for designing comprehensive research programs using Recombinant Cuscuta gronovii Apocytochrome f?

Designing a comprehensive research program centered on Recombinant Cuscuta gronovii Apocytochrome f should incorporate these key elements:

  • Interdisciplinary Approach: Combine structural biology, biochemistry, molecular biology, and evolutionary biology perspectives to fully understand the protein's characteristics and significance.

  • Comparative Framework: Include parallel studies of homologous proteins from:

    • Other Cuscuta species with varying degrees of parasitism

    • Non-parasitic relatives in Convolvulaceae

    • Model photosynthetic organisms

  • Technological Integration: Employ complementary methodologies including:

    • Advanced imaging (cryo-EM, super-resolution microscopy)

    • Functional assays (electron transfer measurements)

    • In vivo studies using transformation systems

    • Computational approaches (molecular dynamics simulations)

  • Evolutionary Context: Position findings within the broader understanding of:

    • The evolution of parasitism in plants

    • Modifications to photosynthetic machinery during transitions to heterotrophy

    • Potential repurposing of proteins for novel functions

  • Collaboration Strategy: Establish partnerships with:

    • Structural biology specialists

    • Plant parasitism experts

    • Bioenergy researchers

    • Evolutionary biologists

This multifaceted approach ensures that research with this recombinant protein contributes meaningfully to our understanding of plant parasitism, protein evolution, and potential biotechnological applications.

What emerging technologies might enhance future studies of Recombinant Cuscuta gronovii Apocytochrome f?

Several cutting-edge technologies are poised to significantly advance research on Recombinant Cuscuta gronovii Apocytochrome f:

  • Cryo-Electron Tomography: Enables visualization of proteins in their native cellular context at near-atomic resolution, potentially revealing the spatial organization of Apocytochrome f in parasite tissues.

  • AlphaFold and Related AI Approaches: Deep learning-based protein structure prediction tools can provide structural models to guide experimental work, particularly valuable for comparing structural features across species.

  • Single-Molecule Techniques:

    • Single-molecule FRET for studying conformational dynamics

    • Optical tweezers for measuring mechanical properties

    • Single-molecule tracking in live cells to study localization and movement

  • Integrative -Omics Approaches: Combining proteomics, transcriptomics, and metabolomics to understand the broader context of Apocytochrome f function in parasitic plants.

  • Genome Editing in Parasitic Plants: The development of transformation protocols for Cuscuta species opens the door to CRISPR-based genome editing for functional studies of petA and related genes.

  • Microfluidic Systems: Design of specialized platforms for studying host-parasite interactions at the cellular level, potentially incorporating recombinant proteins to investigate their roles at the interface.

  • Quantum Biology Approaches: Emerging techniques to study quantum effects in electron transfer processes could provide unprecedented insights into the functional properties of electron transport chain components like Apocytochrome f.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.