Recombinant Cuscuta gronovii ATP synthase subunit b, plastid (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline for your use.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; ATP synthase subunit b, plastid; ATP synthase F(0 sector subunit b; ATPase subunit I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-180
Protein Length
full length protein
Species
Cuscuta gronovii (Common dodder)
Target Names
atpF
Target Protein Sequence
MKDVTYYLISLASQSPAGSFGLNTNNLVTTLINIAVVLSLLIVFGKGFLRDFLDTRKNRI VNTIQISDELYSGAVEKLEKAQARLCKVEKEAKQLRVTGYSEIEQEKLNLINSTYKTLER LEKKKKETCSFEQQRAINDVRQWVLQQTLQRVLKTLNGSLNPELHLHTIRVNISMLGTLK
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F(1) catalytic core (extramembraneous) and the F(0) membrane proton channel. These domains are connected by a central and a peripheral stalk. ATP synthesis in the F(1) catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits.
Protein Families
ATPase B chain family
Subcellular Location
Plastid membrane; Single-pass membrane protein.

Q&A

Advanced Research Questions

  • How do structural modifications in Cuscuta gronovii ATP synthase subunit b reflect adaptation to a parasitic lifestyle?

Structural modifications in C. gronovii ATP synthase subunit b provide key insights into molecular adaptations to parasitism:

i) Transmembrane domain adaptations: The ATP synthase subunit b contains hydrophobic regions that anchor it in the thylakoid membrane. Subtle amino acid substitutions in these regions may reflect adaptations to altered membrane composition in plastids with reduced photosynthetic function.

ii) Protein-protein interaction surfaces: The regions involved in interactions with other ATP synthase subunits show evolutionary constraints, maintaining essential structural features while allowing parasitism-specific modifications. These modifications may optimize ATP synthase assembly in the altered cellular environment of a parasitic plant.

iii) Regulatory regions: Comparative sequence analysis reveals modifications in regions likely involved in regulation of ATP synthase activity, potentially reflecting altered energy demands in parasitic plants.

iv) Post-translational modification sites: C. gronovii ATP synthase subunit b contains predicted phosphorylation and other modification sites that may differ from non-parasitic plants, suggesting parasite-specific regulatory mechanisms.

v) Functional domain conservation: Despite these modifications, functional domains critical for ATP synthesis are largely conserved, consistent with the retention of limited photosynthetic capacity and the essential nature of ATP production even in parasitic plants .

These structural adaptations represent evolutionary innovations that balance maintaining essential ATP synthase function while adapting to the unique physiological constraints of a parasitic lifestyle.

  • What experimental approaches are most effective for studying the function of recombinant Cuscuta gronovii ATP synthase in vitro?

A comprehensive approach to studying recombinant C. gronovii ATP synthase function combines multiple methodologies:

i) Reconstitution systems:

  • Incorporation of purified ATP synthase subunits into liposomes

  • Measurement of proton translocation using pH-sensitive fluorescent dyes

  • Assessment of ATP synthesis driven by artificially imposed proton gradients

ii) Enzyme kinetics:

  • ATP hydrolysis assays using colorimetric phosphate detection

  • ATP synthesis measurement via luciferin/luciferase bioluminescence

  • Determination of kinetic parameters (Km, Vmax) under varying conditions

iii) Structural biology approaches:

  • Circular dichroism spectroscopy for secondary structure analysis

  • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

  • Cryo-electron microscopy for complex assembly visualization

iv) Protein-protein interaction studies:

  • Bimolecular fluorescence complementation (BiFC) to visualize interactions

  • Surface plasmon resonance for binding kinetics determination

  • Chemical cross-linking coupled with mass spectrometry

v) Comparative analyses:

  • Side-by-side functional comparison with ATP synthase from non-parasitic plants

  • Measurement of activity under varying physiological conditions mimicking parasite environments

These approaches collectively provide insights into how structural adaptations in C. gronovii ATP synthase influence its function in the context of a parasitic lifestyle.

  • How does gene expression of ATP synthase subunit b in Cuscuta gronovii compare with related species having different degrees of parasitism?

Comparative analysis of ATP synthase gene expression across Cuscuta species reveals adaptive patterns correlating with parasitism levels:

i) Expression patterns across species:

  • C. reflexa (higher photosynthetic capacity): Maintains expression patterns more similar to autotrophic plants

  • C. gronovii (restricted photosynthetic activity): Shows altered expression regulation

  • E. virginiana (achlorophyllous parasite): Further reduction in ATP synthase expression

ii) Transcriptional regulation differences:

  • Loss of plastid-encoded RNA polymerase in C. gronovii significantly impacts transcription regulation of plastid genes including atpF

  • Altered promoter usage with increased reliance on nuclear-encoded polymerase

iii) Post-transcriptional processing:

  • Significant reduction in RNA editing in C. gronovii compared to less parasitic species

  • Modified splicing patterns affecting atpF transcript processing

iv) Tissue-specific expression:

  • Expression in haustoria (parasite-host connection points) suggests potential roles in host-parasite interactions

  • Differential expression between vegetative and reproductive structures

v) Metabolic context:

  • Correlation between ATP synthase expression and nutrient acquisition from hosts

  • Potential responsiveness to host-derived signals

These expression patterns reflect evolutionary adaptations to varying degrees of parasitism, balancing reduced photosynthetic capacity with maintained energy production requirements.

  • What methodological approaches can be used to study interactions between Cuscuta gronovii ATP synthase subunits?

Studying subunit interactions within the C. gronovii ATP synthase complex requires multiple complementary techniques:

i) In vitro binding assays:

  • Pull-down assays using tagged recombinant subunits

  • Isothermal titration calorimetry for thermodynamic parameters

  • Microscale thermophoresis for interaction in solution

ii) Visualization techniques:

  • Bimolecular fluorescence complementation (BiFC) in heterologous systems

  • FRET/BRET for real-time interaction monitoring

  • Proximity ligation assay for detecting interactions in fixed samples

iii) Cross-linking strategies:

  • Chemical cross-linking followed by mass spectrometry

  • Site-specific photo-cross-linking with non-natural amino acids

  • Hydrogen-deuterium exchange mass spectrometry for interaction interfaces

iv) Structural approaches:

  • Cryo-electron microscopy of reconstituted complexes

  • X-ray crystallography of co-purified subunits

  • NMR for dynamic interaction studies of smaller subunits

v) Computational methods:

  • Molecular docking simulations

  • Molecular dynamics to predict interaction stability

  • Coevolution analysis to identify interacting residues

Several studies have successfully used bimolecular fluorescence complementation to visualize protein interactions in related systems, as demonstrated with FT and FD proteins in Cuscuta species , suggesting its applicability for ATP synthase subunit interaction studies.

  • How do plastid membrane lipid compositions affect Cuscuta gronovii ATP synthase function?

The composition of plastid membranes in parasitic plants likely plays a crucial role in ATP synthase function, though this remains an understudied area:

i) Lipid-protein interactions:

  • The hydrophobic transmembrane regions of ATP synthase subunit b interact directly with membrane lipids

  • Changes in lipid composition can affect protein conformation, lateral mobility, and complex assembly

ii) Parasitism-specific membrane adaptations:

  • Reduced photosynthetic activity in C. gronovii likely correlates with altered thylakoid membrane composition

  • Parasitic plants may show different galactolipid:phospholipid ratios compared to autotrophic plants

iii) Methodological approaches:

  • Lipidomic analysis of isolated plastids using mass spectrometry

  • Reconstitution of ATP synthase in liposomes with defined lipid compositions

  • Fluorescence anisotropy measurements to assess membrane fluidity effects on ATP synthase function

iv) Functional consequences:

  • Membrane thickness affects hydrophobic matching with transmembrane domains

  • Lipid headgroup composition influences proton conductance relevant to ATP synthase function

  • Lipid microdomain organization may affect ATP synthase clustering and efficiency

v) Evolutionary implications:

  • Selection pressure on ATP synthase structure likely co-evolved with changes in membrane composition

  • Comparative lipidomic analysis across Cuscuta species with different parasitism levels could reveal adaptive patterns

This research area represents an important frontier in understanding how parasitic plants adapt their energy production machinery to their unique lifestyle.

  • What are the challenges in studying plastid proteins from parasitic plants, and how can they be addressed?

Investigating plastid proteins from parasitic plants presents unique challenges requiring specialized approaches:

i) Material limitations:

  • Difficulty cultivating parasitic plants in the absence of suitable hosts

  • Requirement for specialized growth conditions, including host-parasite co-cultivation systems

  • Solution: Development of standardized growth protocols using model host plants like Arabidopsis or tobacco under controlled conditions

ii) Genomic complexities:

  • Reduced gene content in parasitic plant plastids complicates genomic analysis

  • Gene transfer to nucleus or functional replacement by nuclear genes

  • Solution: Combined analysis of plastid and nuclear genomes, transcriptomics, and proteomics to capture the complete genetic context

iii) Post-transcriptional modifications:

  • Altered RNA editing patterns in parasitic plants affect protein sequence prediction

  • Solution: Comprehensive RNA-seq to identify editing sites, coupled with proteomic validation

iv) Protein isolation challenges:

  • Obtaining sufficient quantities of native proteins from parasitic plant plastids

  • Solution: Optimization of heterologous expression systems for recombinant production

v) Functional analysis limitations:

  • Lack of established transformation protocols for most parasitic plants

  • Solution: Development of virus-induced gene silencing approaches or host-induced gene silencing

vi) Evolutionary context:

  • Need for appropriate comparisons across species with varying parasitism levels

  • Solution: Systematic studies across parasitism gradients, from facultative to obligate parasites

These methodological approaches can overcome the inherent challenges of studying plastid proteins from these fascinating evolutionary intermediates.

  • How can recombinant Cuscuta gronovii ATP synthase be used to study the evolution of parasitism in plants?

Recombinant C. gronovii ATP synthase provides a powerful tool for investigating evolutionary aspects of plant parasitism:

i) Comparative biochemistry:

  • Side-by-side functional comparison of ATP synthase from C. gronovii (restricted photosynthesis), C. reflexa (higher photosynthetic capacity), and non-parasitic relatives

  • Measurement of enzyme kinetics, efficiency, and regulatory properties to identify parasitism-specific adaptations

ii) Structure-function analysis:

  • Creation of chimeric proteins combining domains from parasitic and non-parasitic plant ATP synthases

  • Identification of specific amino acid changes responsible for functional differences

  • Computational modeling validated by experimental testing

iii) Ancestral sequence reconstruction:

  • Inferring ancestral sequences of ATP synthase at key evolutionary nodes

  • Expression and characterization of reconstructed ancestral proteins

  • Tracking the stepwise evolution of functional changes during parasitism development

iv) Molecular clock analyses:

  • Dating ATP synthase adaptations in relation to the evolution of parasitism

  • Identifying periods of accelerated evolution versus conservation

  • Correlating molecular changes with ecological transitions

v) Host-parasite co-evolution:

  • Examining how ATP synthase adaptations correlate with host range expansion

  • Testing compatibility of recombinant ATP synthase with components from potential host species

vi) Metabolic context integration:

This evolutionary framework helps reconstruct the molecular path from autotrophy to parasitism, with ATP synthase serving as a key marker of this transition.

  • What role might ATP synthase play in haustorium development in Cuscuta gronovii?

The haustorium, the specialized organ through which Cuscuta species establish vascular connections with their hosts, represents a critical innovation in parasitic plants. ATP synthase may play several important roles in haustorium development and function:

i) Energy provision:

  • Haustorium development requires significant energy for cell division, growth, and penetration

  • ATP synthase activity may be upregulated during haustorium formation to meet increased energy demands

ii) Expression patterns:

  • RNA-seq data from related Cuscuta species show expression of plastid genes, including ATP synthase components, in haustorial tissues

  • This suggests localized energy production may be important at the host-parasite interface

iii) Proton gradient utilization:

  • Beyond ATP production, the proton gradient generated by ATP synthase may serve alternative functions in haustorial cells

  • Potential roles in secondary active transport systems for nutrient acquisition from hosts

iv) Signaling functions:

  • ATP synthase components may have moonlighting functions in signaling pathways

  • Parasite detection of host signals might involve ATP synthase-dependent mechanisms

v) Research methodologies:

  • Immunolocalization using antibodies against recombinant ATP synthase subunits

  • Laser capture microdissection coupled with proteomics to study haustorial ATP synthase

  • Metabolic labeling to track ATP production and utilization during haustorium development

vi) Comparative context:

  • Comparison with other parasitic plant lineages that evolved haustoria independently

  • Examination of convergent adaptations in energy production at host-parasite interfaces

Understanding ATP synthase's role in haustorium development provides insights into the molecular basis of this key parasitic innovation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.