Recombinant Cuscuta gronovii Photosystem I assembly protein Ycf4 (ycf4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. If you require a specific tag, please specify it in your order; we will prioritize its implementation.
Synonyms
ycf4; Photosystem I assembly protein Ycf4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Cuscuta gronovii (Common dodder)
Target Names
ycf4
Target Protein Sequence
MSWRSEQIWIELIPGSRRGSNFVWAFILFFGSLEFILVGTASYFSQNLIAFFPQGMVMIF YGISGLFISLYLSSMLFWNVGGGYNQFDKTRGVICIFRWVFPGRNRRLLLRFFMKDIRSI RIEVKEGFYTRRLLYMDIRGQKAIPLTRTDEVLTPVEIEKKAAELASFLCVPIEVL
Uniprot No.

Target Background

Function

Ycf4 appears essential for the assembly of the photosystem I complex.

Protein Families
Ycf4 family
Subcellular Location
Plastid thylakoid membrane; Multi-pass membrane protein.

Q&A

How does the ycf4 gene in C. gronovii compare to other Cuscuta species?

The ycf4 gene in C. gronovii has been retained despite significant gene loss in the plastome due to parasitic lifestyle adaptation. Comparative analysis shows that C. gronovii has a plastome size of 86,727 bp with a total of 97 genes, including the ycf4 gene .

Within Cuscuta species, there are two main evolutionary groups with different patterns of gene loss:

  • Group 1 (including C. gronovii, C. australis, C. obtusiflora, C. pentagona, etc.): Retains more plastid genes

  • Group 2 (including C. exaltata, C. japonica, and C. reflexa): Shows greater gene deletion rates

Unlike some parasitic plants that have lost most photosynthesis-related genes, C. gronovii has maintained ycf4, suggesting its potential importance beyond photosynthesis or its relatively recent transition to a fully parasitic lifestyle .

What methods are recommended for expressing and purifying recombinant Ycf4 protein from C. gronovii?

For expressing and purifying recombinant C. gronovii Ycf4:

  • Cloning approach: The ycf4 gene (coding for 176 amino acids) should be PCR-amplified from C. gronovii plastid DNA and inserted into an appropriate expression vector.

  • Expression system: Due to the membrane-associated nature of Ycf4, an E. coli-based expression system with modifications for membrane proteins is recommended. Consider using strains like C41(DE3) or C43(DE3) designed for membrane protein expression.

  • Purification strategy:

    • Solubilize membrane fractions using mild detergents (DDM, LDAO, or Triton X-100)

    • Purify using affinity chromatography (His-tag or TAP-tag approaches as demonstrated for other Ycf4 proteins)

    • Further purify via ion exchange chromatography and size exclusion chromatography

  • Storage conditions: Store in Tris-based buffer with 50% glycerol at -20°C for short-term or -80°C for long-term storage. Working aliquots can be maintained at 4°C for up to one week .

How can researchers assess the functional role of Ycf4 in C. gronovii despite its parasitic lifestyle?

To assess Ycf4 function in the parasitic C. gronovii:

  • Comparative expression analysis: Quantify ycf4 transcript levels across different developmental stages and tissues of C. gronovii using RT-qPCR, comparing expression between haustorial regions (parasitic connection points) and non-haustorial tissues.

  • RNAi or CRISPR-based knockdown/knockout: Modify the ycf4 gene expression using transformation methods adapted for parasitic plants and evaluate phenotypic changes. Similar approaches in other species like Chlamydomonas reinhardtii demonstrated that ycf4 disruption prevents photoautotrophic growth and PSI complex assembly .

  • Protein interaction studies: Use pull-down assays with TAP-tagged Ycf4 to identify interaction partners in C. gronovii, similar to the approach used for other species that identified associations with PSI subunits (PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF) and COP2 .

  • Host-parasite transfer experiments: Investigate whether Ycf4 function or stability is influenced by host-derived factors by growing C. gronovii on different host plants (particularly hosts with varying photosynthetic capacities) .

What experimental approaches can determine if Ycf4 in C. gronovii is still involved in photosystem I assembly?

To determine if Ycf4 maintains its PSI assembly function in C. gronovii:

  • Biochemical isolation of complexes:

    • Isolate thylakoid membranes from C. gronovii

    • Solubilize using detergents (0.5-1.0% n-dodecyl-β-D-maltoside)

    • Separate complexes via sucrose gradient ultracentrifugation and ion exchange chromatography

    • Identify components using mass spectrometry and immunoblotting

  • Electron microscopy visualization:

    • Analyze purified Ycf4-containing complexes using transmission electron microscopy

    • Perform single particle analysis to determine if structures resemble the large (>1500 kD) complexes observed in other species

  • Pulse-chase protein labeling:

    • Use radiolabeled amino acids to track newly synthesized PSI polypeptides

    • Determine if they associate with Ycf4-containing complexes as intermediate assembly products

  • Functional complementation:

    • Express C. gronovii Ycf4 in ycf4-knockout mutants of model photosynthetic organisms

    • Assess restoration of PSI assembly and function

How do researchers reconcile the retention of ycf4 in C. gronovii with its parasitic lifestyle?

Several hypotheses can explain ycf4 retention despite parasitism:

  • Evolutionary timing: The parasitic lifestyle of C. gronovii evolved relatively recently, and there hasn't been sufficient time for complete loss of photosynthesis-related genes. Research shows C. gronovii exhibits low intraspecific diversity, consistent with recent adaptation to parasitism .

  • Functional repurposing: Ycf4 may have acquired alternative functions beyond PSI assembly. To test this:

    • Perform transcriptomic and proteomic analyses under various stress conditions

    • Identify non-photosynthetic processes affected by ycf4 modification

    • Analyze protein interaction networks to detect novel partners outside photosynthesis

  • Residual photosynthetic capacity: C. gronovii may retain limited photosynthetic activity. Research suggests:

    • Perform comparative physiological measurements (oxygen evolution, electron transport rates)

    • Analyze chlorophyll fluorescence parameters under different light conditions

    • Examine ultrastructure of plastids via transmission electron microscopy

  • Selective pressure from host interactions: The ycf4 gene product might influence host-parasite relationships. Studies show dodder vines can take up host-derived compounds like glucosinolates , suggesting complex metabolic interactions that might maintain selective pressure on certain plastid genes.

What patterns of sequence conservation and divergence are observed in Ycf4 across Cuscuta species?

Sequence analysis of Ycf4 across Cuscuta species reveals interesting evolutionary patterns:

  • Differential conservation rates: While Ycf4 in non-parasitic plants typically shows 41-52% sequence identity across diverse lineages, parasitic Cuscuta species exhibit more variable conservation patterns .

  • Subgenus-specific evolution: Different subgenera of Cuscuta show distinct patterns:

    • Subgenus Monogynella (C. reflexa, C. exaltata): Retains larger plastomes (~121-125 kbp) with ycf4 present as a pseudogene

    • Subgenus Grammica (including C. gronovii): Smaller plastomes (~85-87 kbp) with greater gene loss but functional ycf4 retention

  • Selective pressure analysis: Calculate the ratio of nonsynonymous to synonymous substitution rates (dN/dS):

    • In non-parasitic plants: dN/dS typically ~0.15 (between tobacco and spinach)

    • In parasitic lineages: Variable but generally higher dN/dS values (0.36-0.81 in some cases)

  • Hypermutation regions: Some Cuscuta species show localized hypermutation in the genomic region containing ycf4, with significantly higher mutation rates than elsewhere in the plastome .

How can researchers distinguish between adaptive evolution and relaxed selection in Ycf4 sequence divergence?

To differentiate between adaptive evolution and relaxed selection:

  • Site-specific selection analysis:

    • Apply models like PAML, MEME, or FUBAR to identify codons under positive selection

    • Compare distribution of positively selected sites with known functional domains of Ycf4

  • Branch-site tests:

    • Implement branch-site models to detect positive selection on specific lineages

    • Previous studies detected positive selection in some Desmodium branches, though this may be an artifact of increased mutation rates

  • Structural consequence analysis:

    • Predict structural changes resulting from amino acid substitutions

    • Evaluate if changes appear randomly distributed (suggesting relaxed selection) or clustered in functional regions (suggesting adaptive evolution)

  • Experimental verification:

    • Express wild-type and variant forms of Ycf4 in a model system

    • Assess functional differences through complementation assays and interaction studies

  • Comparative analysis with other plastid genes:

    • Calculate dN/dS ratios for multiple plastid genes to establish baseline relaxation rates

    • Determine if ycf4 evolves significantly differently from this baseline

What methodological approaches can determine the impact of plastome rearrangements on ycf4 expression and function?

To assess how plastome rearrangements affect ycf4:

  • Genomic context analysis:

    • Compare the genomic neighborhood of ycf4 across Cuscuta species

    • In C. gronovii, ycf4 typically exists in a polycistronic transcriptional unit (rps9-ycf4-ycf3-rps18)

    • Analyze whether rearrangements have altered this arrangement

  • Transcriptome analysis:

    • Perform strand-specific RNA-seq to identify transcriptional units containing ycf4

    • Map transcription start sites and termination sites using 5' and 3' RACE

    • Compare transcript abundance and processing patterns between species with different genomic arrangements

  • Promoter analysis:

    • Characterize the promoter regions of ycf4 in various Cuscuta species

    • Test promoter activity using reporter gene constructs

  • DNA methylation and chromatin structure:

    • Analyze epigenetic modifications around the ycf4 locus

    • Determine if rearrangements have altered the chromatin environment

  • Engineered plastome variants:

    • Where transformation systems exist, create artificial rearrangements of the ycf4 region

    • Assess impacts on transcription, translation, and protein function

What expression system optimization strategies are most effective for producing functional recombinant Ycf4?

Optimizing recombinant Ycf4 expression requires addressing the challenges of membrane protein production:

  • Expression system selection:

    Expression SystemAdvantagesDisadvantagesBest For
    E. coliFast growth, high yieldPotential misfoldingInitial screening, structural studies
    YeastPost-translational modificationsLower yieldFunctional studies
    Insect cellsBetter folding of eukaryotic proteinsMore complex, expensiveInteraction studies
    Cell-freeAvoid toxicity issuesLimited scaleRapid testing
  • Vector design considerations:

    • Fusion tags: N-terminal vs. C-terminal placement (C-terminal tags have been successful for Ycf4 in previous studies)

    • Promoter strength: Tunable promoters to prevent inclusion body formation

    • Codon optimization: Adjust for expression host preferences

  • Solubilization optimization:

    • Test multiple detergents: DDM, LDAO, Triton X-100, digitonin

    • Screen detergent concentrations (0.5-2%)

    • Consider addition of lipids during purification to maintain protein stability

  • Purification strategy refinement:

    • Two-step affinity purification using TAP-tag technology has proven effective for Ycf4

    • Additional size exclusion chromatography to separate different oligomeric states

How can advanced imaging techniques be applied to study Ycf4 localization and dynamics in C. gronovii?

Advanced imaging approaches for Ycf4 study include:

  • Confocal microscopy with fluorescent protein fusions:

    • Generate transgenic C. gronovii expressing Ycf4-GFP/YFP fusions

    • Track protein localization during parasite development and host attachment

    • Perform FRAP (Fluorescence Recovery After Photobleaching) to assess protein mobility

  • Super-resolution microscopy:

    • Apply STORM (Stochastic Optical Reconstruction Microscopy) or PALM (Photoactivated Localization Microscopy) to visualize Ycf4 organization at nanometer resolution

    • Determine if Ycf4 forms distinct complexes or domains within thylakoid membranes

  • Electron microscopy approaches:

    • Immuno-gold labeling with Ycf4-specific antibodies for TEM visualization

    • Cryo-electron microscopy of purified Ycf4-containing complexes

    • Tomographic reconstruction to obtain 3D structural information

  • Live-cell imaging during host-parasite interaction:

    • Dual-labeling of host and parasite proteins

    • Time-lapse imaging during haustorial development

    • FRET (Förster Resonance Energy Transfer) to detect potential interactions with host proteins

What bioinformatic approaches can predict novel functions of Ycf4 in parasitic plant systems?

To predict novel Ycf4 functions bioinformatically:

  • Protein domain and motif analysis:

    • Identify conserved domains using tools like PFAM, SMART, PROSITE

    • Search for novel motifs that emerged specifically in parasitic lineages

    • Compare with proteins of known function sharing similar motifs

  • Structural prediction and modeling:

    • Generate 3D structural models using AlphaFold2 or RoseTTAFold

    • Compare with structures of proteins with known functions

    • Identify potential binding sites for novel interaction partners

  • Co-evolution network analysis:

    • Identify genes that show correlated evolutionary patterns with ycf4

    • Construct gene co-evolution networks to predict functional associations

  • Molecular docking simulations:

    • Predict binding of Ycf4 to known PSI components

    • Screen for potential novel interaction partners

  • Transcriptomic correlation analysis:

    • Analyze RNA-seq data to identify genes with expression patterns correlated with ycf4

    • Look for enrichment of specific pathways among correlated genes

How should researchers interpret contradictory findings regarding Ycf4 essentiality across different species?

When interpreting contradictory findings:

  • Context-dependent essentiality:

    • In Chlamydomonas reinhardtii: Ycf4 disruption prevents photoautotrophic growth and PSI assembly

    • In cyanobacteria: Ycf4-deficient mutants can still assemble PSI, though at reduced levels

    • In tobacco: Ycf4 appears to be a non-essential assembly factor

  • Methodological approach reconciliation:

    • Evaluate differences in gene knockout/knockdown techniques

    • Consider growth conditions (light intensity, nutrient availability)

    • Examine whether partial functional redundancy exists in some species

  • Evolutionary compensation mechanisms:

    • Investigate if alternative assembly factors emerge in species where Ycf4 is less essential

    • Consider the evolutionary history of each species studied

  • Quantitative vs. qualitative essentiality:

    • Distinguish between complete loss of function vs. reduced efficiency

    • Measure PSI assembly rates rather than just steady-state levels

  • Experimental design for resolving contradictions:

    • Perform reciprocal complementation studies

    • Test under identical environmental conditions

    • Use standardized quantification methods

What controls and validation steps are critical when studying Ycf4 in a parasitic plant system?

Critical controls and validation steps include:

  • Genetic identity confirmation:

    • Verify Cuscuta species identity using established molecular markers

    • Use the ten molecular markers identified to distinguish C. gronovii from medicinal Cuscuta species like C. chinensis and C. australis

  • Host influence controls:

    • Compare Ycf4 expression and function in parasites grown on different host plants

    • Include controls to account for potential transfer of host-derived compounds

  • Developmental stage standardization:

    • Standardize sampling based on parasite developmental stages

    • Account for potential differences between pre-attachment, early attachment, and mature haustorial connections

  • Cross-contamination prevention:

    • Implement rigorous protocols to prevent host DNA/RNA/protein contamination

    • Design parasite-specific primers and antibodies

    • Include host-only controls in all analyses

  • Multiple methodological approaches:

    • Confirm key findings using independent techniques

    • Combine genetic, biochemical, and imaging approaches

How can researchers address technical challenges in studying membrane-bound proteins in non-model parasitic plants?

To overcome technical challenges:

  • Membrane protein extraction optimization:

    • Test multiple buffer compositions and detergent types

    • Optimize solubilization conditions specifically for Cuscuta tissues

    • Consider native extraction methods to preserve protein-protein interactions

  • Limited material strategies:

    • Implement micro-scale protein purification protocols

    • Use highly sensitive detection methods (e.g., mass spectrometry with multiple reaction monitoring)

    • Develop tissue culture systems for parasitic plants to generate more material

  • Heterologous expression challenges:

    • Test expression in multiple systems (bacteria, yeast, insect cells)

    • Optimize codon usage for the chosen expression system

    • Consider fusion with solubility-enhancing tags (MBP, SUMO)

  • Protein structure determination:

    • Apply native mass spectrometry for membrane protein complexes

    • Use detergent screening for crystallization trials

    • Consider newer approaches like cryo-EM for structure determination

  • Alternative functional assays:

    • Develop in vitro reconstitution systems for PSI assembly

    • Implement split-reporter assays for protein-protein interactions

    • Use proteoliposomes to study membrane protein function

What emerging technologies could revolutionize our understanding of Ycf4 function in parasitic plants?

Emerging technologies with potential impact include:

  • CRISPR-based technologies:

    • Prime editing or base editing for precise modification of ycf4 in C. gronovii

    • CRISPRi for reversible gene repression to study temporal aspects of function

    • CRISPR screens to identify functional interactions

  • Single-cell approaches:

    • Single-cell RNA-seq to characterize cell-type-specific expression

    • Single-cell proteomics to detect differential protein accumulation

    • Spatial transcriptomics to map gene expression within the parasite body

  • Proximity labeling methods:

    • BioID or APEX2 fusions to identify protein interaction networks in vivo

    • Time-resolved proximity labeling to capture dynamic interactions

  • Advanced microscopy:

    • Lattice light-sheet microscopy for extended live imaging

    • Correlative light and electron microscopy to link function and ultrastructure

    • Super-resolution imaging of protein complexes

  • Long-read sequencing:

    • Direct RNA sequencing to detect post-transcriptional modifications

    • Long-read DNA sequencing to resolve complex genomic arrangements

    • Methylation detection to identify epigenetic regulation

What interdisciplinary research approaches might yield novel insights into Ycf4 biology in parasitic systems?

Promising interdisciplinary approaches include:

  • Systems biology integration:

    • Multi-omics data integration (genomics, transcriptomics, proteomics, metabolomics)

    • Network modeling of host-parasite interactions

    • Machine learning to identify patterns in complex datasets

  • Ecological context studies:

    • Field-based research on natural host ranges and performance

    • Community-level effects of parasite-host interactions

    • Climate change impacts on parasitic plant physiology and host relationships

  • Evolutionary developmental biology:

    • Comparative development of chloroplasts in parasitic vs. autotrophic relatives

    • Plastid inheritance and selection in parasite populations

    • Developmental timing of plastid gene expression

  • Synthetic biology approaches:

    • Minimal plastome design and synthesis

    • Engineering novel functions into Ycf4

    • Creating synthetic host-parasite interfaces for controlled studies

  • Translational research connections:

    • Connecting parasitic plant biology to agricultural management strategies

    • Exploring potential biotechnological applications of parasite-derived proteins

    • Developing parasitic plant-based experimental systems for studying host-pathogen interactions

How might research on C. gronovii Ycf4 inform broader understanding of photosynthetic complex assembly?

Research on C. gronovii Ycf4 can inform broader understanding by:

  • Establishing minimal requirements for function:

    • Identify conserved domains/residues essential for PSI assembly

    • Determine if parasitic versions maintain core functions despite sequence divergence

    • Define the minimal functional unit through deletion analysis

  • Understanding evolutionary flexibility and constraints:

    • Compare Ycf4 function across the parasitism continuum (from facultative to obligate parasites)

    • Identify sequence features that predict functional retention versus loss

    • Map the evolutionary trajectory of gene loss in plastid assembly pathways

  • Elucidating novel regulatory mechanisms:

    • Investigate how parasites regulate photosynthetic complex assembly in response to host connection

    • Identify signals that coordinate nuclear and plastid gene expression

    • Discover potential host-derived factors that influence assembly processes

  • Informing synthetic biology approaches:

    • Define minimal requirements for photosystem assembly

    • Develop simplified systems for photosystem engineering

    • Create modular components for synthetic photosynthesis applications

  • Revealing unexpected functions:

    • Discover potential secondary roles of photosystem assembly factors

    • Identify novel protein-protein interactions in non-photosynthetic contexts

    • Understand how proteins can be repurposed during evolutionary transitions

What standardized protocols should researchers adopt when comparing Ycf4 function across species?

Standardized protocols should include:

  • Gene expression quantification:

    • RT-qPCR with validated reference genes specific to parasitic plants

    • Standard primer design parameters across studies

    • Reporting of raw Cq values alongside normalized data

  • Protein extraction and detection:

    • Standardized membrane protein extraction protocols

    • Validated antibodies or consistent epitope tag approaches

    • Quantification against defined standards

  • Functional assays:

    • Consistent growth conditions for complementation studies

    • Standardized photosynthetic measurements (chlorophyll fluorescence, P700 oxidation)

    • Uniform protein complex isolation procedures

  • Data reporting requirements:

    • Complete sequence information with accession numbers

    • Detailed methodological documentation to enable reproduction

    • Raw data deposition in appropriate databases

  • Taxonomic verification:

    • Molecular confirmation of species identity

    • Voucher specimens for morphological verification

    • Documentation of host species when studying parasites

How should researchers design experiments to distinguish between direct and indirect effects of Ycf4 modification?

To distinguish direct from indirect effects:

  • Temporal resolution studies:

    • Use inducible gene expression/repression systems

    • Perform time-course analyses to establish cause-effect relationships

    • Apply rapid protein degradation systems (auxin-inducible degrons) for acute depletion

  • Rescue experiments:

    • Complement with wild-type and mutant versions to identify essential domains

    • Use chimeric proteins to map functional regions

    • Perform heterologous complementation across species

  • Isolated system approaches:

    • Develop in vitro reconstitution systems for PSI assembly

    • Use purified components to test direct interactions

    • Apply cell-free expression systems to eliminate cellular context

  • Targeted mutagenesis:

    • Create specific point mutations rather than whole gene knockouts

    • Design mutations that affect specific functions or interactions

    • Use structure-guided approaches to predict functional consequences

  • Multi-level omics:

    • Integrate transcriptome, proteome, and metabolome analyses

    • Establish causality through network analysis

    • Identify primary versus secondary effects through time-resolved studies

What statistical and data analysis approaches are most appropriate for comparative studies of Ycf4 evolution?

Appropriate statistical and data analysis approaches include:

  • Sequence evolution analysis:

    • Maximum likelihood models for dN/dS calculation

    • Bayesian approaches for ancestral sequence reconstruction

    • Codon-based models to detect site-specific selection

    • Proper alignment curation before evolutionary analyses

  • Phylogenetic comparative methods:

    • Account for phylogenetic non-independence using phylogenetic generalized least squares (PGLS)

    • Apply models of trait evolution (Brownian motion, Ornstein-Uhlenbeck)

    • Test for correlated evolution between traits

  • Structural data analysis:

    • Apply molecular dynamics simulations to assess functional impact of mutations

    • Use normal mode analysis to identify conserved dynamic properties

    • Implement statistical coupling analysis to detect co-evolving residues

  • Meta-analytical approaches:

    • Standardize effect sizes across studies

    • Account for publication bias

    • Implement multi-level models to handle nested data structures

  • Machine learning applications:

    • Develop predictive models for gene loss patterns

    • Classify sequences based on functional retention probability

    • Identify complex patterns in multi-dimensional data

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.