Recombinant Cuscuta gronovii Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Description

Definition and Molecular Overview

The Recombinant Cuscuta gronovii Photosystem Q(B) protein is a synthetic version of the native D1 protein (encoded by the psbA gene) from the parasitic plant C. gronovii. This protein is a core component of Photosystem II (PSII), critical for light-driven water oxidation and electron transport in photosynthesis. The recombinant form is produced in Escherichia coli and includes an N-terminal His-tag for purification .

Production and Stability Considerations

The recombinant protein is purified via affinity chromatography and lyophilized or stored in a glycerol-containing buffer to prevent degradation. Critical handling practices include:

  • Storage Conditions: Avoid repeated freeze-thaw cycles. Long-term storage at -80°C is advised for lyophilized samples .

  • Reconstitution: Rehydration in sterile water is recommended, with glycerol (5–50%) added to stabilize the protein during storage .

Functional Role in Photosystem II

The Q(B) protein (D1) acts as a plastoquinone-binding site in PSII, enabling electron transfer from Q(A) to the plastoquinone pool. Key insights from studies include:

  • Photoinactivation Mechanism: Under low light, charge recombination between Q(B)- − and oxidized donor-side states (S₂/S₃) generates reactive oxygen species (ROS), damaging the D1 protein .

  • Photoprotection: Proton-mediated stabilization of Q(A)- − via bicarbonate ligand dynamics prevents back electron flow to P₆₈₀, reducing oxidative damage .

Evolutionary Context in Cuscuta Species

While many Cuscuta species exhibit plastid genome reduction due to parasitism, C. gronovii (subgenus Grammica) retains functional psbA and other photosynthetic genes . Comparative analyses reveal:

  • Gene Retention: Unlike holoparasitic Cuscuta species (e.g., C. europaea), C. gronovii preserves core PSII components, enabling limited photosynthetic activity .

  • Phylogenetic Position: C. gronovii belongs to a clade with partial photosynthetic capacity, distinct from non-photosynthetic Cuscuta species .

Research Applications

The recombinant Q(B) protein is utilized in:

  • ELISA Kits: For detecting anti-Q(B) antibodies or studying PSII dynamics .

  • Mechanistic Studies: Investigating ROS-mediated D1 degradation and photoprotection pathways .

Comparative Analysis of Cuscuta Plastid Genomes

SpeciesSubgenusPhotosynthetic GenesKey Observations
C. gronoviiGrammicaRetains psbA, atp genesPartial photosynthetic ability
C. europaeaCuscutaLacks psbA, rbcLHoloparasitic, no photosynthesis
C. reflexaMonogynellaRetains psbA, reduced thylakoidsLow-rate photosynthesis

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, we recommend briefly centrifuging the vial to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We determine the tag type during production. If you have a specific tag type in mind, please inform us, and we will prioritize development with the specified tag.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Cuscuta gronovii (Common dodder)
Target Names
psbA
Target Protein Sequence
MTVVLDRRKSENLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFLIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASIAEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAIAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTESESANKGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVIGIWFTALGISTMAFNLNGF NFNQSVVDSKGHVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H(2)O, generating O(2) and a proton gradient, which is subsequently used for ATP formation. It comprises a core antenna complex that captures photons and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, as well as several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid membrane; Multi-pass membrane protein.

Q&A

What is the photosynthetic capacity of Cuscuta gronovii compared to other Cuscuta species?

Cuscuta gronovii maintains photosynthetic capacity but with restricted efficiency compared to non-parasitic plants. Studies indicate that despite being holoparasitic, C. gronovii possesses functional chloroplasts, albeit with reduced photosynthetic activity. Comparative analysis with other Cuscuta species reveals significant variation in photosynthetic capability across the genus.

To properly assess this capacity, researchers should employ OJIP fluorescence analysis, which reveals significantly lower fluorescence in parasitic tissues compared to reference plants like Arabidopsis thaliana. Quantitative measurements show reduced values of minimal and maximal fluorescence (parameters Fo and Fm) in C. gronovii tissues, resulting from a low density of photosynthetic structures (RC/CSo) . The number of reaction centers (RC) is particularly diminished in the outer cortex tissues, while the relative size of the plastoquinone pool per reaction center (N) is larger than in non-parasitic reference plants .

Molecular evidence further supports the retention of photosynthetic function, as C. gronovii has maintained all photosynthetic and photorespiratory genes in its plastid genome with minimal exceptions, indicating strong selective pressure for retention of these pathways despite the parasitic lifestyle .

How does the Photosystem II architecture in C. gronovii differ from non-parasitic plants?

The Photosystem II (PSII) architecture in C. gronovii shows distinctive adaptations reflecting its parasitic lifestyle. Analysis of antenna complexes using JIP-test parameters reveals that the size of PSII antenna complexes (ABS/RC) is larger in the outer cortex than in the inner cortex or in reference plants . This structural adaptation likely compensates for the reduced number of reaction centers.

For investigating these structural differences, researchers should employ a combination of:

  • Chlorophyll fluorescence measurements with detailed OJIP analysis

  • Difference curves calculations using double normalization of raw prompt fluorescence signals

  • Analysis of specific bands (L, K, H, and G) in difference curves that reveal efficiency variations at different stages of photosynthesis

What methods are most effective for isolating and characterizing Photosystem Q (B) protein from C. gronovii?

Isolating Photosystem Q (B) protein from C. gronovii requires careful consideration of the plant's unique tissue structure and metabolic adaptations. The most effective protocol combines differential centrifugation with affinity chromatography, adapted specifically for parasitic plant tissues.

Recommended isolation procedure:

  • Harvest fresh C. gronovii tissue, separating inner and outer cortex regions

  • Homogenize in buffer containing protease inhibitors and reducing agents

  • Perform differential centrifugation to isolate thylakoid membrane fractions

  • Solubilize membranes using mild detergents (0.5-1% n-dodecyl β-D-maltoside)

  • Purify using ion exchange chromatography followed by size exclusion

  • Verify protein identity through Western blotting with antibodies against conserved regions

For characterization, combine spectroscopic methods with functional assays:

  • Measure electron transfer rates between QA and QB using fluorescence decay kinetics

  • Analyze binding properties with electron acceptors using isothermal titration calorimetry

  • Assess thermal stability compared to non-parasitic plant equivalents

The isolation should account for the reduced photosynthetic structures (RC/CSo) in C. gronovii tissues and the altered size of the PSII antenna complexes .

How can the functional activity of Photosystem Q (B) protein be measured in C. gronovii?

Measuring the functional activity of Photosystem Q (B) protein in C. gronovii requires specialized approaches that account for its adapted photosynthetic machinery. The most informative techniques focus on electron transport dynamics and binding characteristics.

Primary measurement techniques:

  • Chlorophyll fluorescence analysis: The OJIP test provides comprehensive information about PSII efficiency, with particular attention to the J-I transition that reflects electron transport beyond QA . The JIP-test parameters offer visualization of differences between C. gronovii tissues and reference plants like A. thaliana .

  • Oxygen evolution measurements: Using Clark-type electrodes to measure oxygen production rates under defined light conditions.

  • Electron transport rate determination: Using artificial electron acceptors such as dichlorophenolindophenol (DCPIP) to assess electron flow through the QB site.

  • Thermoluminescence measurements: To assess charge recombination events involving the QB site.

Data interpretation should consider that C. gronovii maintains the core photosynthetic machinery genes but with altered efficiency, as evidenced by the altered values of fluorescence parameters and the number of QA redox turnovers .

What genetic modifications have been observed in photosynthetic genes of C. gronovii compared to autotrophic plants?

C. gronovii exhibits significant genetic modifications in its photosynthetic apparatus while remarkably retaining all photosynthetic and photorespiratory genes with only minor exceptions . This selective retention suggests continued functional importance despite the parasitic lifestyle.

Key genetic observations include:

  • Retention of photosynthetic genes: Despite extensive changes in gene content and increased nucleotide substitution rates, C. gronovii maintains all core photosynthetic genes, indicating strong evolutionary selection pressure .

  • Loss of RNA polymerase genes: C. gronovii shows parallel losses of genes for plastid-encoded RNA polymerase subunits and their corresponding promoters .

  • Loss of splicing factor: The first documented loss of the gene for the putative splicing factor MatK from the plastid genome is observed in C. gronovii .

  • Reduced RNA editing: A significant reduction in RNA editing sites characterizes the C. gronovii genome compared to autotrophic plants .

  • tRNA and ribosomal gene losses: C. gronovii has lost a largely overlapping set of transfer-RNA and ribosomal genes as found in other parasitic plants like Epifagus virginiana .

These modifications reflect the evolutionary transition toward parasitism while maintaining minimal but sufficient photosynthetic capacity. Despite these changes, photosynthetic genes remain under the highest constraint of any genes within the plastid genomes of Cuscuta species .

How does repeat-mediated recombination influence photosynthetic gene expression in C. gronovii?

Repeat-mediated recombination significantly impacts genomic structure and potentially affects photosynthetic gene expression in C. gronovii. Recent sequencing of the complete circular mitochondrial genome revealed complex structural variability driven by specific repeat sequences .

The C. gronovii mitogenome spans 304,467 base pairs and contains 33 protein-coding genes, 3 rRNA genes, and 18 tRNA genes . Beyond its primary circular structure, alternative genomic conformations were discovered and validated, driven by five specific repeat sequences:

  • Three inverted repeats initiated rearrangements resulting in seven distinct chromosomal structures

  • Two direct repeats split a larger molecule into two subgenomic entities

This genomic plasticity likely influences gene expression patterns, including those related to photosynthesis. Though primarily observed in the mitochondrial genome, similar mechanisms may affect plastid DNA, where photosynthetic genes reside. Researchers investigating these effects should:

  • Employ long-read sequencing technologies (Oxford Nanopore) to capture complete structural variants

  • Validate recombination events using PCR spanning predicted breakpoints

  • Correlate structural variants with transcriptomic data to assess expression differences

  • Analyze protein levels using quantitative proteomics to determine functional consequences

These recombination events may represent adaptive mechanisms allowing C. gronovii to maintain necessary photosynthetic function while optimizing for its parasitic lifestyle.

What role do assembly factors play in maintaining PSII function in C. gronovii?

Assembly factors play crucial roles in maintaining PSII function in C. gronovii despite its reduced photosynthetic capacity. Several key proteins identified in other plant systems likely have homologs in C. gronovii that contribute to PSII assembly, stability, and repair.

Key assembly factors and their potential functions in C. gronovii include:

Assembly FactorFunctionLikely Role in C. gronovii
CPRabA5eSmall Rab GTPase involved in transport of photosynthetic proteins to developing thylakoids May facilitate limited thylakoid development in C. gronovii
CtpA2Essential for C-terminal processing of D1 protein in de novo PSII assembly Critical for maintaining minimal PSII assembly in parasitic context
LQY1PDIase activity involved in PSII repair; associates with CP43-less PSII monomer May contribute to stress tolerance in variable host environments
RBD1Required for assembly/stability of PSII in photosynthetic organisms Likely maintained for basic PSII function
CYP38/TLP40Regulates dephosphorylation of PSII subunits during repair May optimize limited PSII resources during stress

Investigating these factors in C. gronovii would reveal how parasitic plants maintain minimal but functional photosynthetic machinery. Research approaches should include:

  • Comparative genomic analysis to identify homologs of known assembly factors

  • Expression profiling under different host-parasite interface conditions

  • Protein-protein interaction studies to map PSII assembly pathways

  • Targeted mutagenesis to assess functional importance in the parasitic context

The presence and activity of these assembly factors would explain how C. gronovii maintains photosynthetic capability despite genomic simplification.

How do RNA editing sites affect photosynthetic protein function in C. gronovii?

RNA editing significantly impacts photosynthetic protein function in C. gronovii, with comprehensive analysis revealing 421 RNA editing sites across protein-coding sequences that influence 33 protein-coding genes . This post-transcriptional modification alters the amino acid sequences of proteins, potentially optimizing their function in the parasitic context.

The distribution of RNA editing sites varies considerably among genes, with particularly high frequencies observed in the nad4 and ccmB genes . Sixteen of these RNA editing sites were experimentally validated through PCR amplification and Sanger sequencing, confirming their presence with 100% accuracy .

For photosynthetic proteins specifically, RNA editing may:

  • Restore conserved amino acids critical for protein function

  • Adjust protein structure for optimized performance under parasitic conditions

  • Regulate protein activity in response to host-derived signals

  • Compensate for deleterious mutations accumulated during genome reduction

Researchers investigating RNA editing in photosynthetic genes should:

  • Compare editing patterns between C. gronovii and non-parasitic relatives

  • Analyze the impact of editing on protein structure through predictive modeling

  • Correlate editing efficiency with environmental conditions

  • Investigate potential host influence on editing patterns

The reduced RNA editing observed in C. gronovii compared to autotrophic plants suggests selective retention of only the most critical editing events for maintaining minimal photosynthetic function.

What experimental approaches can detect metabolite transfer between host plants and C. gronovii photosystems?

Detecting metabolite transfer between host plants and C. gronovii photosystems requires sophisticated experimental approaches that can track molecules across the host-parasite interface without disrupting the natural interaction. Multiple complementary techniques should be employed.

Recommended experimental approaches:

  • Isotopic labeling studies:

    • Use 13C-labeled CO2 to trace carbon assimilation and transfer

    • Track 15N-labeled compounds to monitor nitrogen transfer

    • Analyze samples using mass spectrometry to quantify labeled metabolites

  • Fluorescent protein fusion systems:

    • Generate transgenic host plants expressing fluorescently tagged photosystem components

    • Monitor potential transfer to parasite tissues using confocal microscopy

    • Quantify fluorescence intensity to estimate transfer efficiency

  • Transcriptomics at the interface:

    • Perform laser-capture microdissection to isolate cells at the host-parasite interface

    • Analyze gene expression patterns related to transport proteins and photosystem components

    • Identify potential regulatory mechanisms governing metabolite exchange

  • Metabolomic profiling:

    • Compare metabolite profiles of host, parasite, and interface tissues

    • Focus on photosynthesis-related compounds including chlorophyll precursors and electron carriers

    • Identify unique signatures indicating directional transfer

This multi-faceted approach can reveal whether metabolites, proteins, and mRNAs related to photosynthesis are transferred from hosts to Cuscuta, potentially influencing parasite photosystem function .

How can comparative genomic analysis of Cuscuta species inform evolutionary adaptation of photosynthetic machinery?

Comparative genomic analysis of Cuscuta species provides crucial insights into the evolutionary adaptation of photosynthetic machinery during the transition to parasitism. The genus Cuscuta represents an excellent model system as it includes species with varying degrees of photosynthetic capacity, from those with functional chloroplasts to achlorophyllous forms with degenerated chloroplasts .

Key analytical approaches:

  • Whole plastid genome comparison:
    Analysis of plastid genomes from multiple Cuscuta species reveals different stages of genome reduction while maintaining photosynthetic gene sets. Despite extensive change in gene content and greatly increased rates of nucleotide substitution, species like C. gronovii retain all photosynthetic and photorespiratory genes with only minor exceptions .

  • Selection pressure analysis:
    Photosynthetic genes are under the highest constraint of any genes within the plastid genomes of Cuscuta, indicating strong selection for retention . This suggests that photosynthesis, even at reduced capacity, provides significant adaptive advantage.

  • Comparative transcriptomics:
    By comparing gene expression patterns across species with different photosynthetic capabilities, researchers can identify core genes essential for minimal photosynthetic function versus those dispensable during parasitic adaptation.

  • Structural biology approaches:
    Comparing protein structures across species can reveal adaptive modifications that optimize photosystem function under parasitic constraints.

This evolutionary perspective provides valuable context for understanding why certain photosynthetic components are retained or modified in C. gronovii. The pattern of gene loss in Cuscuta differs from other parasitic plants like Epifagus virginiana, which has lost all photosynthesis-related genes, suggesting different adaptive strategies .

What are the best practices for heterologous expression of C. gronovii photosystem proteins?

Heterologous expression of C. gronovii photosystem proteins presents unique challenges due to their membrane-associated nature, complex folding requirements, and potential cofactor dependencies. Optimized protocols have been developed to address these challenges.

Recommended expression systems and conditions:

  • Expression system selection:

    • E. coli strains optimized for membrane proteins (C41/C43) for smaller subunits

    • Insect cell systems (Sf9/Hi5) for larger, multi-domain proteins

    • Plant-based expression systems (Nicotiana benthamiana) for proteins requiring plant-specific post-translational modifications

  • Vector design considerations:

    • Include purification tags that minimally interfere with protein folding (C-terminal His6)

    • Incorporate cleavable fusion partners to enhance solubility (MBP, SUMO)

    • Consider codon optimization for expression host while maintaining critical regions

  • Expression conditions optimization:

    • Reduce expression temperature (16-20°C) to facilitate proper folding

    • Include specific cofactors in growth media when required

    • Induce expression at precise cell density to maximize yield

  • Extraction and purification:

    • Use mild detergents for membrane protein solubilization (DDM, LMNG)

    • Implement two-step purification to enhance purity

    • Validate protein integrity through activity assays specific to the target protein

For specific photosystem proteins, consider their location within thylakoid membrane complexes and their interaction partners when designing expression strategies. Proteins associated with the QB site, for instance, may require lipid reconstitution to maintain native conformation.

How can researchers effectively measure photosynthetic efficiency in C. gronovii under different environmental conditions?

Measuring photosynthetic efficiency in C. gronovii under varying environmental conditions requires specialized approaches that account for its parasitic lifestyle and adapted photosynthetic machinery. A comprehensive assessment protocol combines multiple measurement techniques.

Multi-parameter assessment protocol:

  • Chlorophyll fluorescence analysis:

    • Perform OJIP test to obtain JIP-test parameters under different conditions

    • Calculate difference curves (DC) between C. gronovii and reference plants

    • Analyze specific bands (L, K, H, and G) in DC that indicate efficiency at different stages

    • Normalize measurements using the equations:
      Vt = (Ft − FO)/(FM − FO)
      ΔVt = Vt(gall) − Vt(reference plant)

  • Gas exchange measurements:

    • Monitor CO2 assimilation rates under controlled light and temperature

    • Calculate light response curves at different developmental stages

    • Determine compensation and saturation points

  • Chlorophyll content analysis:

    • Quantify chlorophyll a/b ratios as indicators of photosystem adaptations

    • Track changes in pigment composition under stress conditions

  • Electron transport rate measurements:

    • Determine electron flow through PSII using artificial electron acceptors

    • Calculate quantum yield of PSII under different light intensities

When comparing different environmental conditions, researchers should establish standardized growth protocols that account for both host plant status and parasite development stage, as these factors significantly influence measurements. The assessment should consider that C. gronovii tissues show lower values of minimal and maximal fluorescence parameters (Fo and Fm) compared to non-parasitic plants due to reduced density of photosynthetic structures .

What quality control measures ensure reliable results when working with recombinant C. gronovii photosystem proteins?

Ensuring reliable results when working with recombinant C. gronovii photosystem proteins requires rigorous quality control measures throughout the experimental workflow. These measures address the unique challenges of working with photosystem components from parasitic plants.

Comprehensive quality control framework:

  • Protein purity verification:

    • SDS-PAGE with densitometry analysis (>95% purity recommended)

    • Mass spectrometry confirmation of protein identity

    • Dynamic light scattering to assess homogeneity

  • Functional validation:

    • Spectroscopic analysis to confirm proper cofactor incorporation

    • Activity assays specific to the protein's role in electron transport

    • Binding assays for interaction partners using surface plasmon resonance

  • Structural integrity assessment:

    • Circular dichroism to verify secondary structure composition

    • Thermal shift assays to determine stability under experimental conditions

    • Limited proteolysis to confirm proper folding

  • Batch consistency verification:

    • Establish reference standards for each recombinant protein

    • Implement statistical process control for production parameters

    • Document lot-to-lot variation with acceptance criteria

  • Storage stability monitoring:

    • Stability testing under different storage conditions

    • Activity retention assays at defined time points

    • Freeze-thaw tolerance assessment

When working specifically with QB site proteins, additional controls should include assessment of quinone binding capacity and electron acceptance rates under standardized conditions. Researchers should also validate results using multiple independent protein preparations to ensure reproducibility.

What are the most promising avenues for engineering enhanced photosynthetic capacity in parasitic plants?

Engineering enhanced photosynthetic capacity in parasitic plants like C. gronovii represents a frontier in plant molecular biology with significant implications for understanding the evolution of parasitism and potentially managing parasitic plant infestations. Several promising research directions have emerged from current knowledge.

Priority research avenues:

  • Targeted restoration of critical photosynthetic components:

    • Identify rate-limiting steps in C. gronovii photosynthesis

    • Reintroduce or enhance expression of key proteins involved in electron transport

    • Focus on optimizing the QB binding site to improve electron flow efficiency

  • Regulatory circuit engineering:

    • Modify light-responsive transcription factors to enhance photosynthetic gene expression

    • Engineer redox-sensitive regulators to better coordinate photosystem assembly

    • Introduce synthetic circuits that respond to host-derived signals

  • Chloroplast structure optimization:

    • Target proteins involved in thylakoid membrane organization

    • Enhance expression of assembly factors like CPRabA5e that influence thylakoid development

    • Introduce modifications to increase reaction center density (RC/CSo), which is notably low in C. gronovii tissues

  • Heterologous expression of optimized photosystem components:

    • Identify more efficient QB protein variants from related species

    • Introduce engineered photosystem components with enhanced electron transfer properties

    • Test synthetic hybrid proteins combining domains from parasitic and non-parasitic plants

  • Host-parasite interface engineering:

    • Modify transport mechanisms to support enhanced photosynthate exchange

    • Develop approaches to regulate the balance between autotrophic and heterotrophic metabolism

These approaches should be guided by the comparative genomic analysis of Cuscuta species, which reveals that photosynthetic genes are under the highest evolutionary constraint , suggesting their continued functional importance despite parasitism.

How might advances in structural biology contribute to understanding C. gronovii photosystem adaptation?

Recent advances in structural biology techniques offer unprecedented opportunities to understand the molecular adaptations of C. gronovii photosystems. These approaches can reveal how parasitic plants modify their photosynthetic machinery while maintaining minimal but essential function.

Key structural biology contributions:

  • Cryo-electron microscopy (cryo-EM):

    • Near-atomic resolution structures of intact photosystem complexes

    • Visualization of unique structural adaptations in C. gronovii photosystems

    • Identification of altered protein-protein interactions in parasitic context

  • Integrative structural biology:

    • Combining X-ray crystallography, NMR, and computational modeling

    • Mapping conformational dynamics of electron transport components

    • Characterizing the QB binding pocket architecture and quinone interactions

  • Time-resolved structural methods:

    • Tracking structural changes during electron transport events

    • Identifying rate-limiting steps in parasitic photosystems

    • Comparing electron transfer kinetics with non-parasitic references

  • In situ structural analysis:

    • Correlative light and electron microscopy of intact thylakoid membranes

    • Visualizing photosystem organization in native membrane environments

    • Mapping spatial distribution of photosynthetic complexes in C. gronovii chloroplasts

These approaches can address fundamental questions about how C. gronovii maintains photosynthetic function despite significant genetic modifications . The findings would bridge molecular data with functional observations, such as the altered fluorescence parameters and reaction center density observed in C. gronovii tissues , providing mechanistic explanations for the parasitic plant's photosynthetic adaptations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.