Recombinant Cuscuta obtusiflora Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-320
Protein Length
Full Length of Mature Protein
Species
Cuscuta obtusiflora (Peruvian dodder)
Target Names
petA
Target Protein Sequence
YPLFAQQGYENPREATGRIVCANCHLANKPVNIEVPQVILPDTVFEAVVQIPYDLQLKQV LSNGKKGGLNVGAVLILPEGFELAPPDRISPELKEKIGKLYFQSYRPNIKNIFVVGPVPG QKYKKITFPILSPNPATNRRAHFLKYPIYVGGNRGRGQIYPDGSKSNNTVFNATASGRVK KIIRNEKGGYEIIIKDGSDSNEVVNLLPPGLEPLVSEGDSIKLDQPLTSNPNVGGFGQDV AEVVLQDPSRVQVLLFFFASIILAQIFLVLKKKQFEKVQLTKINL
Uniprot No.

Target Background

Function
Recombinant *Cuscuta obtusiflora* Apocytochrome f (petA) is a component of the cytochrome b6-f complex. This complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome f family
Subcellular Location
Plastid thylakoid membrane; Single-pass membrane protein.

Q&A

What is Apocytochrome f and what is its function in Cuscuta obtusiflora?

Apocytochrome f refers to the precursor form of cytochrome f before heme attachment. In Cuscuta obtusiflora, as in other plants, cytochrome f (encoded by the petA gene) functions as a critical component of the cytochrome b6f complex in the electron transport chain of photosynthesis. Despite being a parasitic plant, C. obtusiflora retains photosynthetic genes including petA under strong selective constraint, suggesting that electron transport through photosystems remains an essential function even in this partially heterotrophic organism .

The biosynthesis of cytochrome f involves a multistep process requiring processing of the precursor protein (apocytochrome f) and subsequent covalent ligation of a c-heme upon membrane insertion. Research has demonstrated that one axial ligand of the c-heme is provided by the α-amino group of Tyr1, which is generated upon cleavage of the signal sequence from the precursor protein . This structure-function relationship is fundamental to understanding the role of this protein in parasitic plant metabolism.

How does the plastid genome of Cuscuta obtusiflora differ from non-parasitic plants in relation to the petA gene?

The plastid genome of C. obtusiflora shows structural changes compared to non-parasitic relatives like Ipomoea purpurea. These include modifications in the inverted repeat (IR) regions of the plastid genome, with the IR containing a portion of the 5' end of ycf1 . Unlike some other parasitic plants such as Epifagus virginiana that have lost all photosynthesis-related genes, C. obtusiflora maintains photosynthetic genes under strong selective constraint, indicating these genes still serve important functions .

For researchers studying plastid genome evolution, C. obtusiflora represents an excellent model for investigating adaptive changes in response to a parasitic lifestyle while still maintaining core photosynthetic functions.

What expression systems are recommended for producing functional Recombinant Cuscuta obtusiflora Apocytochrome f?

Several expression systems have been successfully employed for producing Recombinant Cuscuta obtusiflora Apocytochrome f, each offering distinct advantages depending on research objectives:

  • E. coli expression system: This bacterial system provides high protein yields and is relatively straightforward to manipulate genetically. Available in both standard (CSB-EP428901CXS1) and biotinylated (CSB-EP428901CXS1-B) formats, the E. coli-expressed protein is suitable for many applications including structural studies .

  • Yeast expression system: Offering eukaryotic post-translational modifications, yeast systems (CSB-YP428901CXS1) may better represent certain aspects of protein folding or modification that occur in the plant environment .

  • Baculovirus expression system: Using insect cells (CSB-BP428901CXS1), this system can produce proteins with complex folding requirements and may be beneficial when studying interactions between apocytochrome f and other proteins .

  • Mammalian cell expression system: Providing the most complex eukaryotic processing environment (CSB-MP428901CXS1), this system may be necessary for certain functional studies requiring specific mammalian post-translational modifications .

For optimal results, researchers should select the expression system that best aligns with their specific experimental objectives, considering factors such as required yield, protein authenticity, and downstream applications.

What techniques can be used to study the processing of Apocytochrome f in parasitic plants?

Investigating apocytochrome f processing in parasitic plants requires specialized techniques that can accommodate their unique biology:

  • Site-directed mutagenesis: This approach has been successfully used to investigate the relationship between protein processing and heme attachment. By substituting key residues like the cysteinyl residues responsible for heme ligation, researchers have shown that heme binding is not a prerequisite for cytochrome f processing .

  • Chloroplast transformation: Using vectors encoding full-length precursor protein or truncated versions lacking the C-terminal membrane anchor can help elucidate the role of different protein domains in processing and function .

  • Pulse-chase experiments: These can track the rates of synthesis and degradation of various forms of cytochrome f, revealing important insights such as the down-regulation effect of the C-terminus membrane anchor on cytochrome f synthesis rates .

  • Comparative genomics: Analysis of the petA gene and surrounding regions across parasitic and non-parasitic relatives can identify sequence adaptations that may influence processing efficiency .

  • Protein localization studies: Using fluorescently tagged fusion proteins to track the subcellular localization of apocytochrome f in different tissues and developmental stages of parasitic plants.

These methodologies have revealed that pre-apocytochrome f adopts a suitable conformation for the cysteinyl residues to be substrates of the heme lyase, and pre-holocytochrome f folds in an assembly-competent conformation .

How does chlorophyll distribution in Cuscuta obtusiflora relate to petA expression patterns?

Cuscuta obtusiflora shows a distinctive pattern of chlorophyll distribution that correlates with its specialized metabolism as a parasitic plant. Unlike fully photosynthetic plants, C. obtusiflora typically exhibits green pigmentation only in specific tissues: inflorescences, fruits, starved seedlings, and stressed stem tips . This restricted chlorophyll distribution suggests tissue-specific regulation of photosynthetic gene expression, including petA.

The retention of photosynthetic genes under strong selective constraint despite limited chlorophyll distribution indicates that these genes, including petA, likely serve important functions even in tissues with minimal photosynthetic activity . This pattern differs from other parasitic plants like Cuscuta exaltata, which shows more extensive chlorophyll distribution throughout stems and inflorescences .

Researchers investigating this relationship should consider tissue-specific transcriptome analysis to correlate petA expression with chlorophyll content across different plant tissues. Additionally, developmental studies tracking changes in petA expression during the transition from autotrophic seedling to parasitic adult could provide valuable insights into the regulation of this gene in response to the establishment of host connections.

What are the optimal reconstitution and storage conditions for lyophilized Recombinant Cuscuta obtusiflora Apocytochrome f?

Optimizing reconstitution and storage conditions is critical for maintaining the integrity and functionality of Recombinant Cuscuta obtusiflora Apocytochrome f. Based on established protocols and research findings, the following methodological approach is recommended:

Reconstitution protocol:

  • Centrifuge the vial containing lyophilized protein briefly prior to opening to bring contents to the bottom.

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

  • Add glycerol to a final concentration of 5-50% for long-term storage stability (50% is the typical default concentration) .

  • Aliquot the reconstituted protein to minimize freeze-thaw cycles.

Storage recommendations:

  • Short-term storage (1-2 weeks): 4°C

  • Medium-term storage (1-6 months): -20°C in glycerol buffer

  • Long-term storage (>6 months): -80°C in glycerol buffer

Critical parameters affecting stability:

  • pH: Maintain at physiological pH (7.2-7.4) to prevent denaturation

  • Ionic strength: 150-200 mM NaCl typically provides optimal stability

  • Reducing agents: Addition of 1-5 mM DTT may help maintain cysteine residues in reduced state

  • Protease inhibitors: Consider including a protease inhibitor cocktail if degradation is observed

It is important to note that while these conditions are generally appropriate for recombinant proteins, researchers should empirically determine the optimal conditions for their specific experimental applications and verify protein integrity before use .

How does the loss of plastid-encoded RNA polymerase in Cuscuta obtusiflora affect transcription of the petA gene?

The complete loss of genes for plastid-encoded RNA polymerase (PEP) in Cuscuta obtusiflora represents a significant adaptation with profound implications for photosynthetic gene expression . This loss necessitates alternative mechanisms for transcribing essential photosynthetic genes, including petA:

  • Transcriptional mechanism shift: In most plants, photosynthetic genes like petA are primarily transcribed by PEP. In C. obtusiflora, transcription must rely exclusively on the nuclear-encoded RNA polymerase (NEP) or potentially novel mechanisms developed during adaptation to parasitism .

  • Promoter architecture: NEP recognizes different promoter elements than PEP, suggesting that the promoter region of petA in C. obtusiflora may have evolved to accommodate NEP recognition, potentially through acquisition of NEP-binding motifs.

  • Transcriptional efficiency: Typically, NEP-dependent transcription is associated with housekeeping genes rather than photosynthetic genes. The retention of photosynthetic genes under strong selective constraint in C. obtusiflora suggests that efficient transcription by alternative polymerases has evolved .

  • Coordination with nuclear genes: The loss of PEP may have necessitated adaptations in the coordination between plastid and nuclear gene expression to maintain stoichiometry of protein complexes containing both plastid and nuclear-encoded subunits.

This unique transcriptional adaptation represents an excellent research opportunity for understanding plastid gene expression evolution in response to major changes in transcriptional machinery. Comparative studies between C. obtusiflora and other Cuscuta species with different degrees of heterotrophy could provide valuable insights into this evolutionary process.

What is the relationship between plastid genome rearrangements and petA function in Cuscuta obtusiflora?

The plastid genome of Cuscuta obtusiflora has undergone substantial structural changes compared to non-parasitic relatives, which may impact petA expression and function in several ways:

These genomic changes are particularly interesting when compared with other parasitic plants. While C. obtusiflora has maintained photosynthetic genes including petA under strong selection, other parasitic plants like Epifagus virginiana have lost all photosynthesis-related genes . This suggests that even with substantial genomic rearrangements, C. obtusiflora has preserved essential functions of cytochrome f in electron transport.

How do selective constraints on the petA gene in Cuscuta obtusiflora compare with other parasitic and non-parasitic plants?

Comparative analysis of selective constraints reveals fascinating evolutionary patterns that reflect the unique biological role of cytochrome f in different plant lifestyles:

Plant SpeciesLifestyleSelective Constraint on petA (dN/dS ratio)Retention of petAPhotosynthetic Capacity
Cuscuta obtusifloraParasiticStrong (< 0.1)YesLimited to specific tissues
Cuscuta exaltataParasiticStrong (< 0.1)YesMore extensive than C. obtusiflora
Epifagus virginianaParasiticN/A (gene lost)NoNone
Ipomoea purpureaNon-parasiticVery strong (< 0.05)YesFull

The retention of petA and other photosynthetic genes in Cuscuta species under strong selective constraint contrasts sharply with the complete loss of these genes in non-photosynthetic parasites like Epifagus virginiana . This pattern suggests that despite their parasitic lifestyle, Cuscuta species maintain important functions related to electron transport through photosystems.

Several key observations about selective constraints in C. obtusiflora:

These findings highlight the evolutionary flexibility of parasitic plants in adapting their photosynthetic machinery to complementary heterotrophic nutrition strategies.

What experimental approaches can elucidate the role of Apocytochrome f in specialized metabolism of parasitic plants?

Understanding the potential specialized roles of apocytochrome f in parasitic plants requires sophisticated experimental approaches that can detect metabolic functions that may differ from those in fully autotrophic plants:

  • Comparative transcriptomics: RNA-seq analysis comparing expression patterns of petA and related genes between different tissues of C. obtusiflora (green vs. non-green) and between C. obtusiflora and non-parasitic relatives can identify co-expression networks that suggest specialized metabolic roles .

  • Metabolomics: Targeted and untargeted metabolomic analyses comparing wild-type plants with those having modified petA expression can identify metabolic pathways affected by cytochrome f function.

  • Protein-protein interaction studies: Techniques such as co-immunoprecipitation, yeast two-hybrid assays, or proximity labeling can identify interaction partners of cytochrome f that might differ between parasitic and non-parasitic plants, suggesting specialized functions.

  • Evolutionary rate heterogeneity analysis: Examining patterns of sequence conservation across different domains of the petA gene can identify regions under different selective pressures, potentially highlighting functionally important sites specific to parasitic lifestyle .

  • Genetic manipulation approaches: RNA interference or CRISPR-based techniques targeting petA expression in specific tissues can help determine the physiological consequences of reduced cytochrome f function.

  • Isotope labeling studies: Using 13C-labeled compounds to trace carbon flow through metabolic pathways in tissues with different levels of petA expression can reveal the contribution of cytochrome f-dependent electron transport to specialized metabolism.

The strong selective constraint on petA despite the parasitic lifestyle of C. obtusiflora suggests that cytochrome f may have evolved specialized functions beyond its classical role in photosynthesis . These functions could include roles in redox balance, photoprotection, or specialized electron transport pathways supporting host-parasite interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.