Recombinant Cuscuta obtusiflora ATP synthase subunit b, chloroplastic (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; ATP synthase subunit b, chloroplastic; ATP synthase F(0 sector subunit b; ATPase subunit I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-180
Protein Length
full length protein
Species
Cuscuta obtusiflora (Peruvian dodder)
Target Names
atpF
Target Protein Sequence
MNDVTYYLISLASQSPAGSFGLNTNNLVTTLINIGVVLCLLIIFGKGFLRNFLDTRKNKI VNTMQISDELYSSAVEKLEKAQARLCKVENEAKQLRVTGYSEIEHEKLNLINSTYKTLER LEKKKKETCSFEQQQAFNDVRQWVLQQTLQRVLKTLNGSFNPELHLRTIRINISMLGTLK
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the extramembranous catalytic F(1) domain and the membrane-embedded proton channel F(0) domain, connected by a central and peripheral stalk. ATP synthesis within the F(1) catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits. This protein is a component of the F(0) channel, forming part of the peripheral stalk and linking F(1) to F(0).
Protein Families
ATPase B chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Cuscuta obtusiflora and how does its plastid genome differ from those of autotrophic plants?

Cuscuta obtusiflora (Peruvian dodder) is a parasitic plant belonging to the Convolvulaceae family (morning glory family) and is classified within the subgenus Grammica . As a parasitic plant, C. obtusiflora has undergone significant plastid genome reduction compared to autotrophic plants.

The plastid genome of C. obtusiflora has been completely sequenced, revealing it has lost several genes typically found in photosynthetic plants . Unlike many autotrophic plants, C. obtusiflora has lost numerous plastid genes, including those involved in photosynthesis, transcription, and translation . This gene loss reflects evolutionary adaptations to its parasitic lifestyle, where it obtains nutrients directly from host plants rather than through photosynthesis.

One notable feature of C. obtusiflora's plastid genome is the divergence of the accD gene, which shows weak hybridization signals in studies compared to probes from related species . This suggests substantial sequence evolution in this gene region.

What is known about the ATP synthase complex in Cuscuta species compared to photosynthetic plants?

ATP synthase in chloroplasts produces adenosine triphosphate (ATP) required for photosynthetic metabolism in autotrophic plants . In photosynthetic plants, the synthesis of ATP is mechanically coupled to the rotation of a c-subunit ring embedded in the thylakoid membrane, driven by proton translocation across this membrane along an electrochemical gradient .

In Cuscuta species, the functionality and composition of ATP synthase vary depending on the species and their degree of reduction in photosynthetic capacity. The hybridization studies across the genus Cuscuta indicate variable retention of ATP synthase genes . C. obtusiflora specifically shows retention of some ATP synthase components but with modified sequences compared to photosynthetic relatives .

The ratio of protons translocated to ATP synthesized varies according to the number of c-subunits per oligomeric ring, which is organism-dependent . This stoichiometric variation may reflect adaptations to different metabolic requirements in parasitic versus autotrophic plants.

How has the atpF gene evolved in the Cuscuta genus?

The atpF gene, which encodes ATP synthase subunit b, has undergone significant evolutionary changes across the Cuscuta genus:

Cuscuta SubgenusatpF StatusIntron StatusEvolutionary Pattern
MonogynellaPresentIntron presentRelatively conserved
CuscutaPresentIntron presentRelatively conserved
Grammica (non-clade O)VariableVariableIntermediate reduction
Grammica (clade O)AbsentN/AComplete loss

In C. obtusiflora, which belongs to subgenus Grammica, atpF has been retained but shows evidence of sequence divergence compared to photosynthetic relatives . The group IIA intron typically found in atpF has been lost in many Cuscuta species, particularly those in clade O of subgenus Grammica .

Interestingly, the loss of the atpF intron is correlated with the loss of matK, which encodes a maturase involved in splicing group IIA introns . This correlation suggests co-evolution between the maturase and its target introns.

What are the recommended approaches for recombinant expression of Cuscuta obtusiflora atpF?

Based on successful methodologies for recombinant expression of plastid proteins, the following approach is recommended for C. obtusiflora atpF:

  • Gene synthesis and optimization: Due to potential rare codon usage in Cuscuta and the hydrophobic nature of membrane proteins, codon optimization for the expression host is critical . Consider using a plasmid with a codon-optimized gene insert to enhance expression.

  • Fusion protein strategy: Express atpF as a soluble fusion protein with maltose binding protein (MBP) to increase solubility . This approach has been successful for other hydrophobic chloroplast proteins like the c₁ subunit of ATP synthase from spinach.

  • Expression system selection: Use BL21 derivative Escherichia coli cells, which have been shown to effectively express eukaryotic membrane proteins when properly engineered .

  • Purification methodology:

    • Express as MBP-atpF fusion protein

    • Cleave from the MBP tag using an appropriate protease

    • Purify using reversed phase column chromatography

  • Verification of structure: Confirm that the purified protein has the correct secondary structure using circular dichroism to verify alpha-helical content characteristic of this membrane protein .

This methodology enables the soluble expression of an otherwise hydrophobic membrane protein and has yielded significant quantities of highly purified product in similar applications .

What techniques are most effective for studying intron splicing in genes like atpF in Cuscuta species?

For investigating intron splicing in Cuscuta atpF and related genes, the following methodological approaches have proven effective:

  • PCR-based assays: Design primers that span expected intron positions to detect presence/absence and splicing efficiency based on amplicon size differences .

  • Hybridization techniques:

    • Slot blot hybridization using probes derived from conserved regions

    • Southern hybridization to verify gene presence and structure

  • Transcript analysis:

    • RT-PCR to detect mature, spliced transcripts

    • 5' and 3' RACE to identify precise splice sites

    • Northern blotting to compare transcript sizes and abundance

  • Comparative genomic approaches:

    • Complete plastid genome sequencing and comparison across species

    • Design primers based on known sequences from related species (e.g., C. obtusiflora, C. exaltata, and Ipomoea purpurea)

  • Selection pressure analysis:

    • Examination of dN/dS ratios in the matK gene, which encodes the maturase involved in splicing group IIA introns like the one in atpF

    • Maximum Likelihood estimations of selective constraints using tools like PAML

These approaches have been successfully employed to track the presence, absence, and functional status of plastid introns across the Cuscuta genus, revealing patterns of co-evolution between introns and their splicing factors .

How does the loss of plastid introns affect expression strategies for recombinant atpF from C. obtusiflora?

The loss of the group IIA intron in atpF in C. obtusiflora has significant implications for recombinant expression strategies:

  • Simplified gene architecture: The absence of the intron simplifies cloning and expression, as there is no need for appropriate splicing machinery in the expression system .

  • Codon optimization requirements: Even without the intron, codon optimization remains crucial as C. obtusiflora has likely experienced different selective pressures on codon usage compared to model organisms .

  • Protein folding considerations: The evolutionary history of atpF in C. obtusiflora may have led to adaptations in protein folding mechanisms. Expression systems should be chosen to accommodate potential differences in folding requirements .

  • Post-translational modification assessment: The parasitic lifestyle of C. obtusiflora may have led to changes in post-translational modifications of atpF. Researchers should verify whether the recombinant protein requires specific modifications for functionality .

  • Expression system selection: Without the need for splicing machinery, prokaryotic expression systems become more viable options for expression of the intron-less atpF gene .

Understanding the evolutionary loss of introns in Cuscuta provides valuable context for optimizing recombinant expression strategies and may offer insights into the functional constraints on the atpF protein.

What are the functional implications of plastid genome reduction for ATP synthase activity in C. obtusiflora?

The reduction of the plastid genome in C. obtusiflora has several significant implications for ATP synthase structure and function:

  • Subunit stoichiometry changes: The ratio of protons translocated to ATP synthesized varies according to the number of c-subunits per oligomeric ring, which may be altered in parasitic plants with reduced energy demands .

  • Altered regulatory mechanisms: With the loss of photosynthetic capacity, the regulation of ATP synthase activity likely differs from that in photosynthetic plants, potentially affecting recombinant protein function .

  • Functional constraints:

Functional AspectIn Photosynthetic PlantsIn C. obtusiflora
Energy sourceLight-driven proton gradientHost-derived metabolites
Regulatory pathwaysLight/dark regulationHost-dependent regulation
Integration with metabolismCoordinated with Calvin cycleAdapted to heterotrophic metabolism
Subunit compositionComplete complementPotentially modified/reduced
  • Evolutionary adaptation: The retention of atpF in C. obtusiflora despite the loss of many other plastid genes suggests it maintains an essential function, possibly in maintaining membrane potential or supporting residual metabolic processes .

  • Cross-compartment interactions: Changes in plastid ATP synthase may necessitate compensatory adaptations in mitochondrial energy production systems, suggesting potential for novel regulatory interactions .

Understanding these functional implications is crucial for correctly interpreting the behavior of recombinant atpF in experimental systems and for designing functional assays that appropriately account for its evolutionary context.

How can comparative genomic analyses inform our understanding of ATP synthase evolution in Cuscuta?

Comparative genomic approaches provide powerful tools for understanding the evolution of ATP synthase in Cuscuta:

  • Evolutionary trajectory mapping:

    • Mapping gene presence/absence across the Cuscuta phylogeny reveals patterns of gene loss and retention

    • Analysis of whole plastid genomes shows that different Cuscuta clades have reached different endpoints in plastid reduction

  • Selective pressure analysis:

    • Calculation of dN/dS ratios reveals changing selective constraints on ATP synthase genes

    • Maximum Likelihood analyses can identify sites under positive, neutral, or purifying selection

  • Intron-exon structure evolution:

    • Correlation between the loss of group IIA introns and the loss of matK suggests co-evolution of splicing machinery and target introns

    • The atpF intron is among those lost on the branch leading to C. nitida, correlating with significant changes in selective pressure on the RNA-binding domain of matK

  • Reductive evolution assessment:

    • Hybridization studies across Cuscuta species reveal a gradient of gene loss, with clade 'O' showing the most extreme reduction

    • The progressive nature of gene loss in the 'K' clade is consistent with the Evolutionary Transition Series hypothesis

These approaches have revealed that ATP synthase components show differential patterns of loss and retention across Cuscuta species, suggesting varying functional constraints and adaptive trajectories .

What are the potential applications of recombinant C. obtusiflora atpF in structural biology studies?

Recombinant C. obtusiflora atpF presents several unique opportunities for structural biology research:

  • Comparative structural studies: The atpF protein from parasitic plants may reveal structural adaptations to non-photosynthetic metabolism, providing insights into structure-function relationships in ATP synthase .

  • Membrane protein crystallization:

    • The potentially simplified structure of C. obtusiflora atpF may offer advantages for crystallization attempts

    • Novel crystallization conditions might be identified that could be applied to other membrane proteins

  • c-ring stoichiometry investigations: The recombinant production of atpF enables studies into the undefined factors affecting c-ring stoichiometry and structure, which directly impact the bioenergetic efficiency of ATP synthase .

  • Structural adaptations to parasitism: Structural studies of C. obtusiflora atpF may reveal how parasitic plants have adapted their energy-generating machinery to a heterotrophic lifestyle .

  • Protein-protein interaction surfaces: The co-evolution of ATP synthase subunits in Cuscuta may have led to unique interaction interfaces that could inform engineering efforts for modified ATP synthases .

The expression and purification system developed for spinach chloroplast ATP synthase subunits could be adapted for C. obtusiflora atpF, enabling the production of significant quantities of highly purified protein suitable for structural studies .

How can understanding atpF evolution in Cuscuta inform broader questions about parasitic plant biology?

The study of atpF evolution in Cuscuta provides valuable insights into several broader questions in parasitic plant biology:

  • Plastid genome fate: The varying degrees of plastid gene retention across Cuscuta species illuminate the process of plastid genome reduction during the evolution of parasitism .

  • Metabolic adaptation trajectories:

    • The retention of ATP synthase components despite loss of photosynthesis suggests important non-photosynthetic functions

    • These patterns help elucidate the step-by-step process of metabolic adaptation to parasitism

  • Minimal plastid genome requirements:

    • Extreme reduction in clade 'O' approaches the theoretical minimal plastid genome

    • This provides a natural experiment in organelle reduction that complements engineered minimal genome projects

  • Parallel evolution patterns:

Parasitic Plant GroupATP Synthase StatusEvolutionary Pattern
Cuscuta subgenus GrammicaVariable retentionProgressive loss
OrobanchaceaeRetention in some genesDivergent sequence evolution
RafflesiaceaeComplete loss suspectedExtreme reduction
  • Host-parasite co-evolution: Understanding the functional constraints on remaining plastid genes in Cuscuta may reveal aspects of host-parasite relationship evolution, including potential gene transfers between host and parasite .

The research on atpF thus contributes to a broader understanding of organellar evolution, metabolic adaptation, and the limits of genome reduction in eukaryotes.

What are the main technical obstacles in purifying functional recombinant ATP synthase components from parasitic plants?

Purification of functional recombinant ATP synthase components from parasitic plants presents several significant technical challenges:

  • Protein hydrophobicity: ATP synthase subunits, including atpF, are typically highly hydrophobic membrane proteins that tend to aggregate during expression and purification .

  • Codon usage optimization: Parasitic plants like C. obtusiflora may have unusual codon usage patterns due to their specialized lifestyle, requiring careful optimization for expression hosts .

  • Post-translational modifications: Potential parasitic plant-specific modifications may be essential for function but difficult to reproduce in heterologous expression systems .

  • Functional assay development: Testing the functionality of isolated ATP synthase components requires either reconstitution with partner subunits or development of specialized assays for individual subunit activities .

This approach has successfully yielded highly purified chloroplast ATP synthase subunits with correct alpha-helical secondary structure from other species and could be adapted for C. obtusiflora atpF.

How can researchers address the challenge of functional characterization of recombinant atpF without other ATP synthase components?

Functional characterization of isolated atpF presents unique challenges that can be addressed through these methodological approaches:

  • Interaction partner co-expression:

    • Co-express atpF with minimal interaction partners required for partial complex assembly

    • Use bacterial two-hybrid or pull-down assays to verify specific protein-protein interactions

  • Lipid reconstitution studies:

    • Reconstitute purified atpF into liposomes to study membrane integration

    • Assess proton conductance using pH-sensitive fluorescent dyes

  • Structural characterization alternatives:

    • Circular dichroism to confirm secondary structure content

    • NMR studies of isotopically labeled protein to examine local structural features

    • Hydrogen-deuterium exchange mass spectrometry to probe dynamic structural properties

  • Complementation assays:

    • Test functional compatibility by expressing C. obtusiflora atpF in systems lacking the endogenous counterpart

    • Assess rescue of function in appropriate knockout model systems

  • Comparative biochemical approach:

    • Parallel characterization of atpF from both C. obtusiflora and closely related autotrophic species

    • Systematic comparison of biophysical properties to identify parasitism-specific adaptations

These approaches collectively provide a robust framework for characterizing the structure and function of recombinant atpF despite the challenges inherent in working with isolated components of multi-subunit membrane protein complexes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.