Recombinant Cuscuta obtusiflora Photosystem I assembly protein Ycf4 (ycf4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
ycf4; Photosystem I assembly protein Ycf4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Cuscuta obtusiflora (Peruvian dodder)
Target Names
ycf4
Target Protein Sequence
MSWRSEQIWIELIPGSRRESNFLWAFILFFGSLEFILVGTASYLRQNLIAFFPQGMVMTF YGISGLFISLYLLSMLFWNVGGGYHQFDKTRGVICIFRWVFPGRNRRLLLRFFMKDIRSI RIEVKEGFYTRRVLYMDIRGQKGIPLTRTDEVLTPVEIEKKAAELASFLCVPIEVL
Uniprot No.

Target Background

Function
Appears essential for the assembly of the photosystem I complex.
Protein Families
Ycf4 family
Subcellular Location
Plastid thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Ycf4 and what role does it play in photosynthetic organisms?

Ycf4 is a chloroplast-encoded thylakoid membrane protein that serves as a critical scaffold component during Photosystem I (PSI) assembly. It functions by stabilizing intermediate subcomplexes consisting of the PsaAB heterodimer and the stromal subunits PsaCDE, while also facilitating the incorporation of the PsaF subunit into this growing complex . The protein typically spans approximately 184-185 amino acids in most photosynthetic organisms, though notable size expansions occur in certain legume species . While Ycf4 is essential for PSI assembly in organisms like Chlamydomonas reinhardtii, it plays a somewhat less critical role in cyanobacteria, where PSI can still assemble at reduced levels in its absence .

What is the typical molecular weight and quaternary structure of recombinant Ycf4 proteins?

While individual Ycf4 proteins typically have a molecular weight of approximately 20-22 kDa (based on their ~184 amino acid length), functional Ycf4 exists within a much larger macromolecular complex. Biochemical studies using tandem affinity purification and subsequent analyses have revealed that Ycf4 participates in a stable complex exceeding 1500 kDa . Electron microscopy of this purified complex shows structures measuring approximately 285 × 185 Å, suggesting the formation of large oligomeric assemblies . This complex contains not only Ycf4 but also the opsin-related protein COP2 and several PSI subunits including PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF . The significant size difference between the isolated protein and the functional complex highlights the extensive protein-protein interactions that characterize Ycf4's biological role.

What are the recommended expression systems for producing recombinant Cuscuta obtusiflora Ycf4?

For expression of recombinant Ycf4 proteins, including those from C. obtusiflora, Escherichia coli-based systems have proven effective and are widely used . When designing an expression strategy:

  • Vector selection: Vectors containing N-terminal or C-terminal histidine tags facilitate subsequent purification. The tag position should consider the protein's membrane-associated nature.

  • Expression strain: BL21(DE3) or Rosetta strains are preferable for membrane proteins like Ycf4.

  • Induction conditions: Lower temperatures (16-20°C) and reduced IPTG concentrations (0.1-0.5 mM) often improve proper folding of membrane-associated proteins.

  • Solubilization approach: Since Ycf4 is a thylakoid membrane protein, extraction requires appropriate detergents. A systematic screening of detergents (DDM, LDAO, or Triton X-100) at various concentrations is recommended to optimize solubilization while maintaining protein structure and function.

  • Purification strategy: Immobilized metal affinity chromatography followed by size exclusion chromatography has proven effective for obtaining pure, functional Ycf4 protein suitable for downstream applications.

For research requiring functional complexes rather than isolated protein, consider co-expression systems that include interaction partners like COP2 or key PSI subunits to promote proper complex formation .

What are the critical parameters for optimizing recombinant Ycf4 folding and stability?

Maintaining proper folding and stability of recombinant Ycf4 requires careful attention to several parameters:

ParameterOptimal RangeRationale
pH7.5-8.0Matches thylakoid lumen conditions
Buffer compositionTris/PBS-basedMaintains physiological conditions
Cryoprotectant5-50% glycerol or 6% trehalosePrevents damage during freeze-thaw cycles
Storage temperature-20°C to -80°CMinimizes degradation during long-term storage
Detergent concentration1-2× CMCSufficient for solubilization without destabilization
Reducing agents1-5 mM DTT or β-mercaptoethanolPrevents inappropriate disulfide formation

Post-purification analysis should include circular dichroism spectroscopy to verify secondary structure integrity and thermal shift assays to assess stability under various buffer conditions . For recombinant Ycf4 intended for functional studies, verification of proper membrane association and co-immunoprecipitation with known interaction partners provides evidence of correct folding.

How can I verify the functional activity of recombinant Ycf4 in vitro?

Verifying functional activity of recombinant Ycf4 should focus on its role in PSI assembly. A comprehensive functional assessment includes:

  • PSI subunit binding assays: Using purified recombinant Ycf4 and isolated PSI subunits (particularly PsaA, PsaB, and PsaF), assess binding affinity through surface plasmon resonance or microscale thermophoresis. Functional Ycf4 should demonstrate specific binding to these components.

  • Reconstitution experiments: Attempt in vitro reconstitution of partial PSI complexes using recombinant Ycf4 as a scaffold. Analysis by blue native PAGE can reveal the formation of higher molecular weight complexes containing Ycf4 and PSI subunits.

  • Complementation studies: If available, transform Ycf4-deficient mutant lines (such as those in Chlamydomonas) with the recombinant C. obtusiflora Ycf4 to assess functional complementation through restoration of PSI assembly and photosynthetic activity.

  • Interaction analysis with COP2: Given the established association between Ycf4 and COP2 in large complexes , co-immunoprecipitation or pull-down assays with these proteins provides evidence of proper interaction capability.

For more advanced validation, pulse-chase protein labeling experiments similar to those described in the literature can confirm the ability of recombinant Ycf4 to associate with newly synthesized PSI polypeptides .

Which domains of Ycf4 are essential for interaction with Photosystem I components?

The functional domains of Ycf4 critical for PSI assembly have been identified through comparative genomics and mutation studies:

  • C-terminal region: The C-terminal portion (approximately residues 120-184) contains highly conserved residues essential for interaction with PSI components. Even in rapidly evolving Ycf4 proteins from Lathyrus species, many of these C-terminal positions remain conserved, indicating their functional importance .

  • Transmembrane domains: Ycf4 typically contains 3-4 transmembrane regions that anchor it in the thylakoid membrane. These domains position the protein appropriately for interaction with membrane-embedded PSI components like PsaA and PsaB.

  • Conserved binding motifs: Specific amino acid motifs mediate the interaction with PSI subunits. While the precise binding interfaces aren't fully characterized, several conserved hydrophobic and charged residues in the stromal-facing portions of Ycf4 likely mediate specific interactions with PSI components.

For targeted structure-function studies, site-directed mutagenesis of these conserved regions followed by binding assays with PSI components can further elucidate the specific residues mediating these interactions. Additionally, investigating whether parasitic plants like Cuscuta have unique adaptations in these interaction domains could provide insights into PSI assembly regulation during the evolution of parasitism.

What is the composition and stoichiometry of the Ycf4-containing complex in vivo?

The Ycf4-containing complex represents a large macromolecular assembly crucial for PSI biogenesis. Biochemical and structural studies have revealed:

  • Size and components: The complex exceeds 1500 kDa and contains Ycf4, the opsin-related protein COP2, and multiple PSI subunits including PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF .

  • Stoichiometry: While precise stoichiometry data is limited, almost all Ycf4 and COP2 in wild-type cells copurify through multiple chromatographic steps, indicating their intimate and exclusive association . The precise ratio of Ycf4 to PSI components likely varies depending on assembly stage.

  • Physical dimensions: Electron microscopy reveals structures measuring approximately 285 × 185 Å, which may represent several oligomeric states of the complex .

  • Assembly dynamics: Pulse-chase protein labeling experiments indicate that the PSI polypeptides associated with the Ycf4-containing complex are newly synthesized and partially assembled as pigment-containing subcomplexes , suggesting this complex represents an intermediate assembly state rather than the final PSI complex.

To fully characterize this complex in different species including C. obtusiflora, a combination of blue native PAGE, sucrose gradient ultracentrifugation, and subsequent proteomic analysis would be required to identify all components and their relative abundances.

How does the Ycf4 complex interact with other photosynthetic assembly factors?

The Ycf4 complex functions within a network of assembly factors that cooperatively facilitate PSI biogenesis:

  • Sequential assembly process: Ycf4 appears to be the second of three scaffold proteins that act sequentially during PSI assembly, with its specific roles being to stabilize an intermediate subcomplex consisting of the PsaAB heterodimer and the three stromal subunits PsaCDE, and to add the PsaF subunit to this subcomplex .

  • COP2 interaction: The consistent copurification of Ycf4 with COP2 suggests an intimate functional relationship between these proteins during PSI assembly . The precise role of COP2 remains to be fully characterized, but its opsin-related nature suggests potential involvement in pigment incorporation or membrane protein folding.

  • Chloroplast chaperone network: Ycf4 likely interacts with general chloroplast chaperones that assist in membrane protein folding and complex assembly. These may include the cpSRP (chloroplast Signal Recognition Particle) pathway components and various stromal chaperones.

  • Cofactor incorporation machinery: Since PSI assembly involves the incorporation of numerous cofactors (including chlorophylls and iron-sulfur clusters), Ycf4 complexes likely coordinate with enzymes involved in cofactor synthesis and incorporation.

For researchers studying C. obtusiflora Ycf4, co-immunoprecipitation followed by mass spectrometry would be valuable for identifying species-specific interaction partners, potentially revealing unique adaptations in this parasitic plant's photosynthetic apparatus.

What evolutionary patterns are observed in Ycf4 across photosynthetic organisms, and how might Cuscuta obtusiflora fit into this pattern?

Ycf4 displays remarkable evolutionary patterns across photosynthetic lineages:

  • Lineage-specific acceleration: In legumes, Ycf4 shows dramatically accelerated evolution compared to other angiosperms, with nonsynonymous substitution rates much higher than in other chloroplast genes . This acceleration begins at specific phylogenetic branches, suggesting episodic selective pressures.

  • Size expansion: While most photosynthetic organisms have Ycf4 proteins of 184-185 amino acids, certain lineages show substantial size expansions, reaching up to 340 residues in some Lathyrus species .

  • Gene loss and transfer: In some legumes like Pisum sativum, Ycf4 has been lost from the chloroplast genome, suggesting potential transfer to the nuclear genome, although nuclear copies have proven difficult to detect .

  • Localized mutation hotspots: In Lathyrus, the genomic region containing Ycf4 shows dramatically elevated mutation rates (20-fold higher than surrounding regions), affecting both the gene and adjacent sequences .

For Cuscuta obtusiflora, which belongs to the parasitic plant family Convolvulaceae, we might expect unique evolutionary patterns related to its partially heterotrophic lifestyle. Parasitic plants often show accelerated evolution in photosynthesis-related genes due to relaxed selective constraints. A full comparative analysis would require sequencing and analysis of the C. obtusiflora Ycf4 region, with special attention to substitution rates, protein size, and evidence of functional conservation despite parasitism.

How do mutation rates in Ycf4 compare across species, and what implications does this have for functional studies?

Mutation rates in Ycf4 show extraordinary variation across plant lineages, with important implications for functional studies:

Plant GroupRelative Mutation RatedN/dS RatioProtein SizeReference
Most angiospermsBaseline~0.15184-185 aa
Legumes (general)5-10× higher0.2-0.4>200 aa
Lathyrus species>20× higher0.36-0.81Up to 340 aa
Desmodium (some species)Very high>1 (pseudogenization)N/A (pseudogene)

These variable mutation rates have significant implications for functional studies:

  • Sequence conservation masking: Traditional sequence conservation analysis may miss functionally important residues in rapidly evolving lineages. For C. obtusiflora studies, it's crucial to compare with diverse reference sequences.

  • Alignment challenges: The high divergence between Ycf4 sequences (less than 31% identity between some Lathyrus species) makes accurate sequence alignment difficult, potentially confounding structure prediction and homology modeling .

  • Functional constraints: Despite high mutation rates, many Ycf4 genes remain functional, suggesting that only specific regions or residues are essential for function. Focusing on these conserved elements may be more productive than whole-protein studies.

  • Experimental design considerations: For C. obtusiflora Ycf4 functional studies, comparing its in vitro properties with those of slowly and rapidly evolving Ycf4 variants may reveal which functional aspects are universally conserved versus lineage-specific adaptations.

What can comparative analysis of parasitic plant Ycf4 proteins reveal about photosynthetic adaptations during the evolution of parasitism?

Comparative analysis of Ycf4 from parasitic plants like Cuscuta obtusiflora offers unique insights into photosynthetic adaptation during the evolution of parasitism:

  • Relaxed selection versus targeted adaptation: By analyzing dN/dS ratios across Ycf4 sequences from parasitic plants at different evolutionary stages of parasitism, researchers can distinguish between general relaxed selection (expected in non-photosynthetic parasites) and targeted adaptive evolution (potential in hemiparasites like some Cuscuta species that retain partial photosynthetic capacity).

  • Structural modifications: Changes in key functional domains might indicate adaptation to reduced or specialized photosynthetic activity. For C. obtusiflora, modifications to the PSI interaction domains could reflect altered PSI assembly requirements in a parasitic context.

  • Complex composition differences: Immunoprecipitation studies of Ycf4 complexes from parasitic plants might reveal different associated proteins compared to autotrophic relatives, potentially indicating rewiring of assembly pathways.

  • Correlation with parasitic strategy: Comparing Ycf4 evolution across parasitic plants with different nutritional strategies (from facultative to obligate parasites) can reveal whether changes correlate with the degree of heterotrophy and photosynthetic reduction.

  • Gene expression regulation: Analysis of Ycf4 expression patterns in parasitic plants might reveal altered regulation associated with the specialized developmental and physiological constraints of the parasitic lifestyle.

This research direction has broader implications for understanding the molecular mechanisms of photosynthetic reduction during the evolution of plant parasitism, potentially informing both evolutionary biology and agricultural approaches to controlling parasitic weeds.

How can recombinant Ycf4 be utilized to study PSI assembly defects in photosynthetic mutants?

Recombinant Ycf4 provides valuable tools for investigating PSI assembly defects:

  • In vitro reconstitution assays: Purified recombinant Ycf4 can be used in reconstitution experiments with isolated thylakoid membranes from PSI assembly mutants to assess whether exogenous Ycf4 can rescue assembly defects. This approach requires:

    • Isolation of thylakoid membranes from mutant plants

    • Incubation with recombinant Ycf4 under physiological conditions

    • Analysis of PSI assembly state using blue native PAGE and immunoblotting

    • Functional assessment through spectroscopic methods

  • Binding partner identification in mutant backgrounds: Immobilized recombinant Ycf4 can be used as bait to capture interaction partners from wild-type versus mutant plant extracts, potentially revealing how specific mutations affect the Ycf4 interactome.

  • Structure-function analysis: Site-directed mutagenesis of recombinant Ycf4 can generate variants mimicking naturally occurring mutations or designed to test specific hypotheses about functional domains. These variants can then be tested for their ability to complement assembly defects in vivo or in vitro.

  • Competitive inhibition studies: Using recombinant Ycf4 fragments containing specific binding domains, researchers can competitively inhibit native Ycf4 interactions to dissect the temporal sequence of assembly events.

For C. obtusiflora specifically, comparing its Ycf4 activity in these assays with Ycf4 from fully autotrophic plants might reveal adaptations related to its parasitic lifestyle.

What techniques are available for visualizing the dynamics of Ycf4-mediated PSI assembly in real-time?

Advanced imaging and biochemical techniques can provide insights into the real-time dynamics of Ycf4-mediated PSI assembly:

  • Fluorescence recovery after photobleaching (FRAP): By creating fluorescently tagged Ycf4 fusion proteins and expressing them in appropriate model systems, FRAP can measure the mobility and exchange rates of Ycf4 within thylakoid membranes, providing insights into its dynamic behavior during PSI assembly.

  • Single-molecule tracking: Using techniques like total internal reflection fluorescence (TIRF) microscopy with fluorescently labeled Ycf4, researchers can track individual molecules to determine diffusion coefficients, binding/unbinding kinetics, and spatial organization within membranes.

  • Time-resolved cryo-electron microscopy: By chemically synchronizing PSI assembly and taking structural snapshots at defined time points, researchers can visualize structural transitions in the Ycf4-PSI assembly complex.

  • Pulse-chase experiments with isotope labeling: Similar to previously described approaches , pulse-chase labeling of newly synthesized proteins combined with immunoprecipitation of Ycf4 complexes at various time points can reveal the temporal sequence of protein association during assembly.

  • Förster resonance energy transfer (FRET): By creating dual-labeled systems with appropriate fluorophore pairs on Ycf4 and various PSI components, researchers can monitor protein-protein interactions in real-time as assembly proceeds.

Each of these techniques requires careful experimental design to maintain the native behavior of the assembly system while enabling sufficient detection sensitivity.

What are the potential applications of understanding Ycf4 function for engineering improved photosynthetic efficiency?

Understanding Ycf4 function opens several avenues for photosynthetic engineering:

  • Optimizing PSI assembly kinetics: Modulating Ycf4 expression levels or activity could potentially accelerate PSI assembly, reducing the lag time during chloroplast biogenesis or recovery from photodamage. This could be particularly valuable for crops experiencing fluctuating light conditions.

  • Enhancing stress tolerance: PSI is particularly vulnerable to photodamage under certain stress conditions. Engineering Ycf4 to enhance assembly efficiency under stress conditions could improve photosynthetic resilience in adverse environments.

  • Adapting to altered PSI compositions: Some photosynthetic engineering strategies involve modifying PSI composition or abundance. Complementary modifications to Ycf4 might be necessary to accommodate these changes and ensure efficient assembly.

  • Cross-species optimization: Comparative analysis of Ycf4 from diverse species, including C. obtusiflora, might identify variants with superior assembly properties under specific conditions. These variants could be transferred to crop species through transplastomic approaches.

  • Synthetic biology applications: As our understanding of the PSI assembly machinery improves, it may become possible to design simplified or specialized photosystems with tailored properties, using modified Ycf4 proteins as part of the assembly toolkit.

For any of these applications, a deep understanding of both Ycf4's molecular mechanism and its evolutionary adaptations across different photosynthetic lineages will be essential.

What are common difficulties encountered when expressing and purifying recombinant Ycf4, and how can they be addressed?

Researchers frequently encounter several challenges when working with recombinant Ycf4:

  • Poor expression yields: As a membrane protein, Ycf4 often expresses at low levels in heterologous systems.

    • Solution: Optimize codon usage for the expression host, reduce expression temperature to 16-18°C, and consider specialized expression strains like C41(DE3) designed for membrane proteins.

  • Inclusion body formation: Improper folding leading to aggregation.

    • Solution: Express as a fusion with solubilizing partners like MBP or SUMO, optimize induction conditions (lower IPTG, lower temperature), or develop refolding protocols from inclusion bodies.

  • Inefficient extraction: Incomplete solubilization from membranes.

    • Solution: Screen multiple detergents (DDM, LDAO, FC-12, etc.) at various concentrations; consider using detergent mixtures or detergent-lipid mixtures that better mimic the native membrane environment.

  • Loss of activity during purification: Destabilization during chromatography steps.

    • Solution: Include lipids (DOPC, DOPG) in purification buffers, minimize exposure to high salt concentrations, and maintain appropriate detergent levels throughout purification.

  • Heterogeneity of purified product: Multiple oligomeric states or degradation products.

    • Solution: Implement rigorous size exclusion chromatography as a final purification step, optimize buffer conditions to maintain a single preferred oligomeric state, and consider adding protease inhibitors throughout the purification process.

For C. obtusiflora Ycf4 specifically, additional challenges may arise from species-specific properties that should be addressed through empirical optimization of these general approaches.

How can researchers distinguish between functional and non-functional recombinant Ycf4 preparations?

Distinguishing functional from non-functional Ycf4 preparations requires multiple complementary approaches:

  • Structural integrity assessment:

    • Circular dichroism spectroscopy to verify secondary structure content

    • Size exclusion chromatography to confirm appropriate oligomeric state

    • Thermal shift assays to measure protein stability

    • Limited proteolysis to assess proper folding

  • Binding assays with known partners:

    • Pull-down assays with PSI components (particularly PsaA, PsaB, and PsaF)

    • Surface plasmon resonance or microscale thermophoresis to measure binding kinetics

    • Co-immunoprecipitation with COP2, which reliably associates with functional Ycf4

  • Functional complementation:

    • Transformation of Ycf4-deficient mutants (if available) to assess restoration of PSI assembly

    • In vitro assembly assays measuring the formation of PSI subcomplexes

  • Biophysical fingerprinting:

    • Native mass spectrometry to verify complex formation

    • Hydrogen-deuterium exchange mass spectrometry to assess proper folding

    • Fluorescence spectroscopy with environment-sensitive probes to verify membrane integration

For quantitative assessment, researchers should establish positive controls (e.g., Ycf4 purified from the native organism) and negative controls (deliberately denatured preparations) to benchmark their recombinant protein's functionality.

What strategies can overcome the challenges of studying membrane proteins like Ycf4 in structural and functional assays?

Membrane proteins like Ycf4 present unique challenges for structural and functional characterization that can be addressed through specialized approaches:

  • Detergent selection optimization:

    • Systematic screening of detergent types and concentrations using thermal stability assays

    • Use of detergent:lipid mixed micelles to better mimic native environment

    • Application of novel amphipathic polymers (amphipols) or nanodiscs that provide a more native-like membrane environment

  • Crystallization alternatives:

    • Lipidic cubic phase crystallization, specifically designed for membrane proteins

    • Cryo-electron microscopy, which avoids the need for crystallization

    • Solid-state NMR for structural determination in a lipid bilayer environment

  • Functional reconstitution:

    • Incorporation into liposomes or nanodiscs for functional studies

    • Co-reconstitution with interaction partners to stabilize native conformations

    • Development of cell-free expression systems coupled with immediate reconstitution

  • Protein engineering approaches:

    • Creation of chimeric constructs with well-behaved proteins

    • Introduction of thermostabilizing mutations identified through directed evolution

    • Removal of flexible regions that might impede structural determination

  • Advanced biophysical techniques:

    • Single-molecule force spectroscopy to probe membrane protein mechanics

    • Hydrogen-deuterium exchange mass spectrometry to analyze protein dynamics

    • Electron paramagnetic resonance spectroscopy with site-directed spin labeling to measure distances between specific residues

These approaches can be tailored to specific research questions about Ycf4 structure, dynamics, and function, enabling comprehensive characterization despite the inherent challenges of membrane protein biochemistry.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.