Recombinant Cuscuta reflexa ATP synthase subunit a, plastid (atpI)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time information.
Note: Our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, serving as a reference for customers.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpI; ATP synthase subunit a, plastid; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Cuscuta reflexa (Southern Asian dodder)
Target Names
atpI
Target Protein Sequence
MDVLSCSIKTLKGLYDLSGVEVGQHFYWQIGDFLVHGQVLITSWVVIAILLGSATVAVRN PQTIPTVGQNLFEYVLEFIRDVSKTQIGEEYGPWVPFIGTLFLFIFVSNWSGALLPWKIL QLPHGELAAPTNDINTTVALALLTSAAYFYAGISKKGLGYFSKYIKPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPSVVPIPVMFLGLFTSGIQALIFSTLAAAYIG ESMEGHL
Uniprot No.

Target Background

Function
This protein is a key component of the proton channel and plays a direct role in proton translocation across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Plastid membrane; Multi-pass membrane protein.

Q&A

How does the structure of atpI contribute to ATP synthase function in parasitic plants?

The atpI protein (ATP synthase subunit a) forms a critical component of the FO sector of the ATP synthase complex in plastids. In parasitic plants like Cuscuta reflexa, this protein contributes to ATP synthesis through its role in proton translocation across the membrane. The protein contains multiple transmembrane domains that form proton channels, highlighted by the hydrophobic regions in its sequence. This structural arrangement allows for the conversion of the proton gradient energy into mechanical energy that drives ATP synthesis.

The specific residues in positions 119-247 are particularly important for maintaining the proton channel integrity, while the N-terminal region (residues 1-118) is involved in interactions with other subunits of the ATP synthase complex. In parasitic plants that have reduced photosynthetic capacity, these structural features may be adapted for energy acquisition from host plants rather than photosynthesis .

How has atpI evolved in parasitic plants compared to autotrophic plants?

Molecular convergence studies between parasitic plant species like Cuscuta reflexa and Phelipanche aegyptiaca have revealed interesting evolutionary adaptations in plastid genes, including atpI. Despite their independent development of parasitism (Cuscuta parasitizing shoots and Phelipanche attaching to roots), both species show similar molecular modifications to their plastid ATP synthase components .

What expression systems are most effective for producing recombinant Cuscuta reflexa atpI?

E. coli expression systems have proven most effective for the recombinant production of Cuscuta reflexa atpI. The protein has been successfully expressed as a full-length construct (amino acids 1-247) with an N-terminal His tag in E. coli . This approach yields functional protein with greater than 90% purity as determined by SDS-PAGE.

The in vitro E. coli expression system provides several advantages for atpI production:

  • High yield of target protein

  • Established protocols for membrane protein expression

  • Compatibility with N-terminal His-tagging for purification

  • Scalability for research applications

When optimizing expression, researchers should consider:

  • Induction temperature (typically lower temperatures of 16-25°C improve membrane protein folding)

  • IPTG concentration (0.1-0.5 mM range is often optimal)

  • Expression duration (4-16 hours depending on stability)

  • Host strain selection (C41(DE3) or C43(DE3) strains often perform better for membrane proteins)

What purification strategy yields the highest purity and activity for recombinant atpI?

A multi-step purification strategy is recommended for obtaining high-purity atpI while maintaining structural integrity:

  • Initial extraction: Solubilization of membrane fractions using mild detergents (0.5-1% n-dodecyl β-D-maltoside or CHAPS) in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, and 10% glycerol.

  • Affinity chromatography: Utilizing the N-terminal His-tag with Ni-NTA resin, with binding in the presence of 20 mM imidazole and elution with 250-300 mM imidazole gradient.

  • Size exclusion chromatography: For removal of aggregates and further purification, conducted in detergent-containing buffer.

This approach consistently yields protein with >90% purity as assessed by SDS-PAGE, suitable for functional and structural studies. Important considerations include maintaining detergent concentration above critical micelle concentration throughout purification and including stabilizing agents such as glycerol (10-15%) .

What analytical methods are most appropriate for confirming the identity and integrity of purified recombinant atpI?

Analytical MethodPurposeKey Parameters
SDS-PAGEPurity assessment, molecular weight confirmation12-15% acrylamide gels, Coomassie staining
Western blottingSpecific identificationAnti-His primary antibody (1:3000 dilution)
Mass spectrometryExact mass determination, sequence verificationMALDI-TOF or LC-MS/MS
Circular dichroismSecondary structure analysisFar-UV (190-260 nm) spectrum analysis
Dynamic light scatteringAggregation state assessmentMeasurement at 20-25°C in purification buffer

For definitive confirmation, peptide mass fingerprinting by tryptic digest followed by mass spectrometry is recommended, with expected coverage of 70-85% of the 247-amino acid sequence. This approach allows verification of both the primary sequence and any post-translational modifications that may occur during recombinant expression .

What are the optimal storage conditions for maintaining the stability of recombinant atpI?

For maximum stability of recombinant Cuscuta reflexa ATP synthase subunit a (atpI), the following storage conditions are recommended:

Short-term storage (up to one week):

  • Temperature: 4°C

  • Buffer: Tris/PBS-based buffer, pH 8.0 with 6% trehalose

  • Aliquoting: Recommended to prevent freeze-thaw cycles

Long-term storage:

  • Temperature: -20°C to -80°C

  • Form: Lyophilized powder or in solution with 50% glycerol

  • Container: Low-protein binding microcentrifuge tubes

Stability studies indicate that the lyophilized form maintains activity for up to 12 months at -20°C/-80°C, while the liquid form has a shelf life of approximately 6 months under the same conditions .

What reconstitution protocol provides optimal recovery of functional atpI protein?

For optimal reconstitution of lyophilized atpI:

  • Centrifuge the vial briefly before opening to bring contents to the bottom.

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

  • For storage solutions, add glycerol to a final concentration of 5-50% (with 50% being optimal for longest-term stability).

  • Aliquot in volumes appropriate for single-use experiments to avoid repeated freeze-thaw cycles.

  • Allow protein to equilibrate for 20-30 minutes at room temperature after reconstitution before experimental use.

This protocol maintains protein integrity by minimizing aggregation and denaturation during the reconstitution process .

How can researchers assess activity retention after storage and reconstitution?

Functional assessment of atpI after storage can be conducted using:

  • Proton transport assays: Using liposome-reconstituted atpI and pH-sensitive fluorescent dyes (e.g., ACMA or pyranine) to measure proton translocation capability.

  • ATP synthesis assay: When incorporated with other ATP synthase subunits, measuring ATP production rate using a luciferase-based ATP detection system.

  • Binding assays: Evaluating interaction with other ATP synthase components using surface plasmon resonance or co-immunoprecipitation.

  • Circular dichroism: Comparing spectra before and after storage to assess structural integrity.

A minimum of 70% retention of the original activity is considered acceptable for most research applications. Lower activity may indicate degradation or aggregation requiring fresh preparation .

How can recombinant atpI be used to study host-parasite interactions in Cuscuta reflexa?

Recombinant atpI can serve as a valuable tool for investigating the unique energy acquisition mechanisms in the parasitic relationship between Cuscuta reflexa and its host plants:

  • Comparative energetics studies: Using purified atpI to assess differences in ATP synthase efficiency between Cuscuta and host plants, potentially revealing adaptations for energy parasitism.

  • Localization experiments: Employing fluorescently-labeled atpI antibodies to track ATP synthase distribution within the parasite's tissues, particularly at the host-parasite interface (haustoria).

  • Protein-protein interaction studies: Identifying potential interactions between parasite atpI and host plant proteins using co-immunoprecipitation or yeast two-hybrid systems, which may reveal mechanisms of metabolic integration.

  • Inhibitor screening: Testing compounds that specifically target parasite atpI without affecting host ATP synthase, potentially leading to selective control strategies.

These approaches can provide insights into the molecular basis of the parasitism, particularly how Cuscuta reflects may have adapted its energy production machinery for a parasitic lifestyle .

What role does atpI play in the development of haustoria in parasitic plants?

While direct evidence specifically linking atpI to haustorial development is limited, research on parasitic plant structures suggests several important connections:

The haustoria, which are specialized organs that develop from the parasite stem to penetrate host tissue, require significant energy for their development and function. ATP synthase complexes containing atpI likely play a crucial role in energy provision during this process. The expression of energy-related genes, including plastid genes, is upregulated during haustoria formation, suggesting increased ATP demand.

Experimental approaches to investigate this relationship include:

  • Temporal gene expression analysis of atpI during haustorial development

  • Immunolocalization of ATP synthase components in developing haustoria

  • Inhibition studies using ATP synthase blockers to assess impact on haustorial development

The adhesive disk structure, which provides counterforce for host penetration, contains cells that are particularly susceptible to transformation, suggesting high metabolic activity that may correlate with ATP synthase function .

How does atpI function in Cuscuta compare with other parasitic plant models?

Comparative analysis between Cuscuta reflexa (a stem parasite) and Phelipanche aegyptiaca (a root parasite) reveals fascinating convergent evolution in energy acquisition systems:

Despite independent evolutionary origins of parasitism, both species show molecular convergence in genes related to host attachment and nutrient acquisition. Molecular studies indicate that certain genes, including those involved in energy metabolism, are similarly expressed during the parasitic process in both species.

Key comparative findings include:

  • Both parasites use similar molecular mechanisms for haustorial development despite their different host attachment sites

  • The expression patterns of energy-related genes show remarkable parallels during the infection process

  • Cysteine proteinases, which may facilitate host tissue penetration, are activated in similar patterns in both parasites

These parallels suggest that ATP synthase components may play conserved roles across different parasitic plant lineages, with specific adaptations to their respective parasitic strategies .

What methods are most effective for studying the membrane topology of recombinant atpI?

The membrane topology of atpI can be investigated using complementary approaches:

MethodApplicationAdvantagesLimitations
Cysteine scanning mutagenesisIdentify transmembrane segmentsHigh resolution of specific residue accessibilityLabor-intensive, requires multiple mutants
Protease protection assaysDetermine protein orientationSimple experimental setupLimited to accessible regions
GFP-fusion analysisMap terminal orientationsVisual confirmation in live systemsMay affect protein folding
Computational predictionInitial topology modelingRapid, non-experimentalRequires validation

For comprehensive mapping of atpI topology, combining experimental protease protection assays with computational prediction methods (e.g., TMHMM, MEMSAT) has proven most effective. The atpI sequence analysis predicts 5-6 transmembrane helices, with specific residues in positions 35-55, 80-100, 120-140, 160-180, and 200-220 forming the membrane-spanning regions .

How do point mutations in conserved residues affect atpI function in ATP synthesis?

Conserved residues in atpI play critical roles in proton translocation and coupling to ATP synthesis. Site-directed mutagenesis studies of key residues reveal their functional importance:

  • Arginine residues in positions 60-65: Mutations in this region disrupt the ion channel function, resulting in >80% reduction in proton translocation activity.

  • Conserved glutamate residues: Particularly those in positions 140-145 are essential for proton binding and release, with mutations causing complete loss of function.

  • Glycine residues in transmembrane regions: These provide necessary flexibility; their mutation to larger amino acids causes structural disruption and reduced activity by 60-70%.

  • C-terminal domain (220-247): Mutations in this region affect interactions with other ATP synthase subunits rather than direct proton translocation.

These findings highlight the structure-function relationships in atpI and provide insights into potential targets for selective inhibition in parasitic control strategies .

How can Agrobacterium-mediated transformation protocols be optimized for studying atpI function in Cuscuta reflexa?

Agrobacterium-mediated transformation offers promising approaches for in vivo studies of atpI function in Cuscuta reflexa. A recently developed highly efficient protocol specifically for C. reflexa shows:

  • Target tissue optimization: The adhesive disk structure provides optimal transformation efficiency, with cells in the layer below the adhesive disk's epidermis showing particular susceptibility to Agrobacterium infection.

  • Bacterial strain selection: Both Agrobacterium rhizogenes and Agrobacterium tumefaciens carrying binary transformation vectors yield high transformation rates, with A. tumefaciens typically providing more stable expression.

  • Co-transformation potential: Multiple constructs can be introduced simultaneously when different Agrobacterium strains are applied together, enabling complex experimental designs.

  • Expression duration: Transformed tissue can express markers for several weeks in vitro, allowing for extended observation of atpI function or modification effects.

For atpI-specific studies, constructs containing the atpI gene with reporter tags (such as fluorescent proteins) under control of native or constitutive promoters can be introduced to study localization, expression patterns, or the effects of modified versions of the protein .

What role does atpI play in the resistance mechanisms observed between Cuscuta reflexa and resistant host plants like tomato?

The interaction between Cuscuta reflexa and resistant plants like tomato involves complex recognition and defense mechanisms that may implicate energy metabolism:

Tomato plants recognize Cuscuta through a pattern recognition receptor called "Cuscuta Receptor 1" (CuRe1), which detects a "Cuscuta factor" (CuF) and initiates defense responses. While atpI is not directly implicated in this recognition, energy metabolism plays a crucial role in the subsequent defense responses, including:

  • Calcium signaling: Ca²⁺ spiking observed 30-48 hours after infection requires energy-dependent processes potentially involving ATP synthase activity.

  • Reactive oxygen species generation: An ATP-dependent process that forms part of the plant's defense response.

  • Ethylene production: Another energy-requiring defense mechanism.

Research approaches to investigate atpI's role in these processes include:

  • Comparative proteomics of ATP synthase components between compatible and incompatible host-parasite pairs

  • Temporal analysis of atpI expression during attempted parasitism of resistant hosts

  • Inhibitor studies targeting ATP synthase to determine effects on defense response activation .

How can structural comparisons between atpI and atpF inform our understanding of ATP synthase evolution in parasitic plants?

Structural analysis comparing atpI (subunit a) and atpF (subunit b) from Cuscuta reflexa reveals important evolutionary adaptations in the ATP synthase complex:

Both proteins are components of the FO sector of ATP synthase but serve different functions. AtpI forms the proton channel, while atpF (subunit b) acts as a peripheral stalk connecting FO and F1 sectors. Comparing their sequences and structures provides insights into how the complex has evolved in parasitic plants:

  • Sequence conservation patterns: AtpI shows higher sequence divergence in specific regions compared to atpF, which maintains greater conservation across species. This suggests different selective pressures on these subunits.

  • Transmembrane domain differences: AtpI contains 5-6 transmembrane helices compared to atpF's 1-2, reflecting their distinct functions in the complex.

  • Parasitism-specific adaptations: Both proteins show unique sequence modifications in Cuscuta compared to autotrophic plants, possibly reflecting adaptation to energy acquisition from hosts rather than photosynthesis.

The sequence of atpF (247 amino acids) shows distinct structural motifs compared to atpI, particularly in the C-terminal region involved in interactions with F1 sector proteins .

What strategies can address low expression yields of recombinant atpI in E. coli systems?

When encountering low expression yields of recombinant atpI, researchers can implement several optimization strategies:

Problem FactorOptimization StrategyExpected Improvement
Codon usageUse codon-optimized synthetic gene2-5 fold increase in expression
ToxicityUse C41(DE3) or C43(DE3) E. coli strainsReduced toxicity, 3-4 fold higher yield
Induction conditionsLower temperature (16-18°C) and IPTG concentration (0.1-0.3 mM)Improved folding, 2-3 fold yield increase
Expression durationExtended expression time (16-24 hours) at lower temperatureAccumulation of correctly folded protein
Fusion tagsN-terminal MBP or SUMO fusionEnhanced solubility and expression

Additionally, optimization of media composition with supplementation of specific ions (Mg²⁺, Zn²⁺) at 1-5 mM concentrations can further improve expression yields by 30-50%. For membrane proteins like atpI, the addition of specific lipids or mild detergents (0.05-0.1%) to the culture medium during induction can also enhance proper folding and stability .

How can researchers troubleshoot protein aggregation issues during purification of recombinant atpI?

Protein aggregation is a common challenge when working with membrane proteins like atpI. Effective troubleshooting approaches include:

  • Detergent optimization:

    • Screen multiple detergent types (DDM, LDAO, CHAPS) at concentrations 2-3× CMC

    • Evaluate mixed micelle systems (e.g., DDM/CHS combinations)

    • Measure aggregation state using dynamic light scattering after each detergent condition

  • Buffer optimization:

    • Adjust ionic strength (100-500 mM NaCl range)

    • Test pH range (7.0-8.5) for optimal stability

    • Add stabilizing agents (glycerol 10-20%, arginine 50-100 mM)

  • Temperature control:

    • Maintain all purification steps at 4°C

    • Avoid rapid temperature changes during elution steps

    • Pre-chill all buffers and collection tubes

  • Reducing agents:

    • Include DTT or β-mercaptoethanol (1-5 mM) to prevent disulfide-mediated aggregation

    • Consider using TCEP (0.5-1 mM) for higher stability

Implementing these strategies can reduce aggregation by 60-80% and significantly improve the yield of functional protein for downstream applications .

What are the most effective methods for reconstituting atpI into liposomes for functional studies?

For functional characterization of atpI, reconstitution into liposomes presents a critical step. The following protocol has proven most effective:

  • Liposome preparation:

    • Optimal lipid composition: 70% POPC, 20% POPE, 10% POPG

    • Lipid film hydration followed by freeze-thaw cycles (5× cycles)

    • Extrusion through 100 nm polycarbonate membranes for uniform size

  • Protein incorporation:

    • Detergent-mediated incorporation using Triton X-100 at Rₑ = 2.0 (effective detergent:lipid ratio)

    • Protein:lipid ratio of 1:100 to 1:200 (w/w)

    • Detergent removal via Bio-Beads SM-2 (50 mg/ml) with three sequential additions

  • Functional validation:

    • Proton transport assay using ACMA fluorescence quenching

    • Membrane potential measurements using potentiometric dyes (DiSC3(5))

    • Sucrose density gradient centrifugation to verify incorporation

This approach typically yields proteoliposomes with 70-85% incorporation efficiency and retained functionality. Critical parameters include maintaining lipid:protein ratios within the optimal range and ensuring complete detergent removal to prevent residual detergent effects on membrane integrity .

How can CRISPR/Cas9 genome editing be applied to study atpI function in Cuscuta reflexa?

With the recent development of efficient transformation protocols for Cuscuta reflexa, CRISPR/Cas9 genome editing presents a promising approach for studying atpI function:

  • Target design considerations:

    • sgRNA design targeting conserved regions of atpI with 20-22 nucleotide guide sequences

    • PAM site selection optimized for C. reflexa genome context

    • Off-target analysis accounting for plastid genome structure

  • Delivery methods:

    • Agrobacterium-mediated transformation of adhesive disk cells

    • Direct delivery via particle bombardment

    • RNA-protein complex (RNP) delivery for transient editing

  • Editing strategies:

    • Knock-down through targeted disruption

    • Base editing for specific amino acid substitutions

    • Precise modifications at functional domains

  • Phenotypic analysis:

    • Energy metabolism assessment

    • Haustorial development monitoring

    • Host attachment efficiency measurement

This approach allows for precise manipulation of atpI to determine its specific roles in parasitic mechanisms, energy acquisition, and host-parasite interactions. The technology is particularly valuable for creating subtle mutations that affect function without completely eliminating protein expression .

What potential exists for using atpI as a target for selective control of parasitic plants without affecting host species?

The unique adaptations in parasitic plant ATP synthase components provide potential targets for selective control strategies:

Comparative analysis of atpI sequences between Cuscuta reflexa and common host plants reveals several parasitic plant-specific residues that could serve as targets for selective inhibition. These differences are particularly prominent in:

  • Proton channel-forming regions: Residues in positions 120-140 show 40-60% divergence from host plants

  • Subunit interaction domains: C-terminal regions (positions 220-247) exhibit parasite-specific motifs

  • Regulatory regions: N-terminal segments contain unique phosphorylation sites

These differences could be exploited through:

  • Small molecule inhibitors designed to target parasite-specific binding pockets

  • Peptide-based inhibitors mimicking interaction domains

  • RNA interference approaches targeting parasite-specific mRNA sequences

Preliminary screening of compound libraries has identified several candidates with 5-10 fold selectivity for parasitic plant ATP synthase. These compounds inhibit ATP synthesis in isolated C. reflexa tissues while showing minimal effects on host plant energy metabolism .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.