Recombinant Cuscuta reflexa Cytochrome c biogenesis protein ccsA (ccsA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Cuscuta reflexa Cytochrome c Biogenesis Protein ccsA (ccsA)

Recombinant Cuscuta reflexa Cytochrome c biogenesis protein ccsA (ccsA) is a protein derived from the Southern Asian dodder, Cuscuta reflexa. This protein plays a crucial role in the biogenesis of cytochrome c, which is essential for electron transport in mitochondria and chloroplasts. The recombinant form of this protein is expressed in Escherichia coli and is often used in research to study cytochrome c biogenesis pathways.

Function and Importance of ccsA

The ccsA protein is part of the cytochrome c biogenesis system, which is responsible for attaching heme to apocytochrome c, converting it into holocytochrome c. This process is vital for the proper functioning of the electron transport chain in both mitochondria and chloroplasts. In plants like Cuscuta reflexa, although they are parasitic and have reduced photosynthetic capabilities, the presence of such proteins indicates a complex metabolic machinery that supports their unique lifestyle.

Expression and Production

The recombinant ccsA protein from Cuscuta reflexa is typically expressed in E. coli using a His-tag for purification. The protein sequence spans 308 amino acids (1-308 aa), with a specific amino acid sequence that facilitates its function in cytochrome c biogenesis .

Research Findings and Applications

Research on the ccsA protein from Cuscuta reflexa contributes to understanding the mechanisms of cytochrome c biogenesis. This knowledge can be applied in various fields, including biotechnology and plant biology, to improve our understanding of electron transport processes and their role in plant metabolism.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please specify it in your order remarks. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
ccsA; Cytochrome c biogenesis protein CcsA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
full length protein
Species
Cuscuta reflexa (Southern Asian dodder)
Target Names
ccsA
Target Protein Sequence
MIVSTLEHILTHISLSIVSILITIELRIFLDDEIKKLYDSSERGMLITFLCITGLLANNW IYLGHFPLSDLSESLIFLSWSFALIHSIGYFTKNLKFLSTITSQSTLFTQGFATSGILTK IQKSSILIPALKSEWLIMHVSLMILGYAALLCGSLLSVALMVITVRNDGKFFFKSNNFLF REISYQNKNFFYAINYYKTQLIKELDFWSYQVISLGFIFLTIGILSGAVWANEAWGSYWS WDPKETWAFITWIVFAIYLHTRININLQSTNSAIVASLGFIIIWICYFGVNLVGLGLHSY GSFPSTSN
Uniprot No.

Target Background

Function
This protein is essential for the biogenesis of c-type cytochromes, specifically cytochrome c6 and cytochrome f. It plays a crucial role in the heme attachment step during their formation.
Protein Families
CcmF/CycK/Ccl1/NrfE/CcsA family
Subcellular Location
Plastid membrane; Multi-pass membrane protein.

Q&A

What is the Cytochrome c biogenesis protein ccsA in Cuscuta reflexa?

Cytochrome c biogenesis protein ccsA in Cuscuta reflexa (Southern Asian dodder) is a protein involved in cytochrome c synthesis, which is critical for photosynthetic function in plants. It has UniProt accession number A7M9A9 and consists of 308 amino acids in its full-length form . The ccsA protein is encoded by the ccsA gene located in the chloroplast genome and is categorized as a photosynthesis-related protein essential for the assembly of the photosynthetic apparatus . Despite Cuscuta species being parasitic plants with reduced photosynthetic capacity, they still retain certain photosynthesis-related genes including ccsA, which makes it an interesting protein for studying the evolution of parasitism in plants .

How is recombinant Cuscuta reflexa ccsA protein typically stored and handled in laboratory settings?

Recombinant Cuscuta reflexa ccsA protein requires specific storage conditions to maintain stability and functionality. The recommended storage protocol includes:

  • Long-term storage: -20°C or -80°C for extended preservation

  • Working aliquots: 4°C for up to one week

  • Storage buffer: Tris-based buffer with 50% glycerol, optimized for protein stability

Important handling considerations include avoiding repeated freeze-thaw cycles, as this can significantly degrade protein quality. When working with the protein, it is advisable to maintain cold chain protocols and use appropriate sterilized containers to prevent contamination . The protein is typically shipped in lyophilized form or in solution with stabilizing agents, and researchers should follow reconstitution protocols specific to their experimental requirements.

What are the recommended protocols for expressing recombinant Cuscuta reflexa ccsA protein in heterologous systems?

Successful expression of recombinant Cuscuta reflexa ccsA protein in heterologous systems requires careful optimization of expression conditions. A recommended protocol typically includes:

  • Vector Selection: Use expression vectors with strong promoters suitable for membrane protein expression (e.g., pET series for bacterial expression, baculovirus vectors for insect cell expression)

  • Host System Selection:

    • E. coli: BL21(DE3) or C41/C43 strains specifically optimized for membrane protein expression

    • Insect cells: Sf9 or Hi5 cells for proteins requiring eukaryotic post-translational modifications

    • Plant expression systems: Nicotiana benthamiana transient expression for maintaining plant-specific folding environment

  • Expression Conditions:

    • Induction: IPTG concentration (0.1-1.0 mM) for bacterial systems

    • Temperature: Lower temperatures (16-25°C) to improve proper folding

    • Duration: Extended expression periods (24-72 hours) at reduced temperatures

  • Extraction and Purification:

    • Utilize detergent-based extraction methods (e.g., n-dodecyl β-D-maltoside or Triton X-100)

    • Employ immobilized metal affinity chromatography (IMAC) for His-tagged constructs

    • Consider size exclusion chromatography as a polishing step

The expression tag will be determined during the production process based on specific research requirements and experimental goals . For membrane proteins like ccsA, including stabilizing agents such as glycerol in purification buffers is crucial for maintaining protein integrity throughout the purification process.

How can researchers verify the functionality of recombinant Cuscuta reflexa ccsA protein after purification?

Verifying the functionality of recombinant Cuscuta reflexa ccsA protein after purification requires multiple analytical approaches:

  • Structural Integrity Assessment:

    • Circular dichroism (CD) spectroscopy to confirm secondary structure elements

    • Size exclusion chromatography to verify proper oligomeric state

    • Limited proteolysis to assess proper folding

  • Functional Assays:

    • Cytochrome c synthesis complementation assays in ccsA-deficient systems

    • Heme binding assays using spectrophotometric methods

    • Reconstitution into liposomes to assess membrane insertion and orientation

  • Interaction Studies:

    • Pull-down assays to verify interactions with other components of the cytochrome c maturation system

    • Surface plasmon resonance (SPR) to quantify binding kinetics with partner proteins

    • Microscale thermophoresis to measure affinities under near-native conditions

  • Activity Monitoring:

    • In vitro heme attachment assays using apocytochrome c as substrate

    • Analysis of cytochrome c biogenesis pathway intermediates using HPLC or mass spectrometry

    • Electron transfer measurements using electrochemical techniques

Thorough validation of protein functionality is crucial before proceeding with advanced research applications, as recombinant membrane proteins often require extensive optimization to maintain native-like activities .

How does the ccsA protein in Cuscuta reflexa differ from orthologs in other parasitic and non-parasitic plants?

The ccsA protein in Cuscuta reflexa exhibits notable differences compared to its orthologs in other plant species, reflecting its evolutionary adaptation to a parasitic lifestyle:

Species TypeccsA FeaturesChloroplast Genome ContextFunctional Implications
Cuscuta reflexa (parasitic)Retained but potentially modified functionReduced chloroplast genome (relative to non-parasitic species)Maintained for residual photosynthetic activity or alternative functions
Other Cuscuta species (parasitic)Variable conservation; some species may lack functional ccsAHighly reduced chloroplast genomesReflects varying degrees of dependence on host plants
Ipomoea species (non-parasitic relatives)Fully functional with conserved domainsComplete photosynthetic gene set in chloroplastEssential for photosynthesis and energy production
Other parasitic plantsConvergent reduction patternsSimilar patterns of gene lossEvolutionary convergence in parasitic adaptation

Cuscuta reflexa has retained the ccsA gene despite losing many other photosynthesis-related genes during its evolution as a parasite . This selective retention suggests that ccsA may serve additional functions beyond photosynthesis or that the species maintains limited photosynthetic capacity compared to other more specialized parasitic plants. Comparative sequence analysis reveals that while the core functional domains of ccsA remain recognizable in C. reflexa, certain sequence modifications may reflect adaptation to its unique ecological niche .

The phylogenetic analysis of chloroplast genomes has revealed that Cuscuta species, including C. reflexa, cluster closely with Ipomoea species despite their distinct parasitic lifestyle, indicating their evolutionary relationship prior to the development of parasitism .

What evolutionary insights can be gained from studying the retention of ccsA in parasitic Cuscuta species?

The retention of the ccsA gene in Cuscuta reflexa provides several key evolutionary insights:

  • Selective Gene Retention: While many photosynthesis-related genes have been lost in Cuscuta species (including ndh complex genes, pbf1, and others), ccsA has been retained, suggesting it may have essential functions beyond photosynthesis . This selective retention pattern helps identify genes that may serve multiple functions in plant metabolism.

  • Evolutionary Transition: The presence of ccsA in a parasitic plant with reduced photosynthetic capacity illustrates the gradual nature of the evolutionary transition from autotrophy to heterotrophy. Cuscuta represents an intermediate state where some photosynthetic machinery is maintained while other components have been lost .

  • Functional Repurposing: The retention of ccsA may indicate functional repurposing, where proteins originally involved in photosynthesis have been co-opted for alternative functions in the parasitic lifestyle, such as metabolite processing from the host plant.

  • Genomic Reduction Dynamics: Studying which genes are retained versus lost in parasitic plants helps elucidate the dynamics of genomic reduction during the evolution of parasitism and identifies which photosynthetic functions are dispensable versus essential.

Comparative analysis of ccsA sequences across multiple Cuscuta species at different stages of parasitic adaptation can reveal the molecular signatures of selection pressure and help reconstruct the evolutionary trajectory toward parasitism . This evolutionary context is crucial for understanding the functional significance of ccsA in modern Cuscuta species.

How can researchers utilize recombinant Cuscuta reflexa ccsA protein to study cytochrome c biogenesis pathways?

Recombinant Cuscuta reflexa ccsA protein serves as a valuable tool for investigating cytochrome c biogenesis pathways through several advanced research approaches:

  • Reconstitution Studies: Researchers can reconstitute the cytochrome c biogenesis system in vitro by combining purified ccsA with other pathway components to investigate:

    • Step-by-step heme attachment mechanisms

    • Rate-limiting steps in the cytochrome c maturation process

    • Structural prerequisites for substrate recognition

  • Structure-Function Analysis:

    • Site-directed mutagenesis of conserved residues to identify essential functional domains

    • Truncation analysis to map minimal functional units

    • Chimeric protein construction with homologs from non-parasitic plants to determine regions responsible for potentially altered function in parasitic context

  • Pathway Mapping:

    • Protein-protein interaction networks using proximity labeling approaches (BioID, APEX)

    • Temporal sequence of assembly events using pulse-chase experiments

    • Subcellular localization studies using fluorescently tagged constructs

  • Comparative Biochemistry:

    • Side-by-side functional assays with ccsA proteins from photosynthetic and non-photosynthetic tissues

    • Kinetic comparisons of activity under varying redox conditions

    • Substrate specificity analysis using cytochromes from different organisms

These approaches can yield insights into not only the fundamental mechanisms of cytochrome c biogenesis but also how these processes may have been modified during the evolution of parasitism in Cuscuta species . Understanding these pathways has broader implications for plant adaptation mechanisms and the evolution of metabolic dependencies.

What are the methodological challenges in studying membrane-associated proteins like ccsA, and how can they be overcome?

Studying membrane-associated proteins like ccsA presents several significant methodological challenges that require specialized approaches:

  • Expression and Purification Challenges:

    • Challenge: Low expression yields and inclusion body formation

    • Solutions:

      • Use specialized expression strains (C41/C43, SHuffle)

      • Employ fusion partners (MBP, SUMO) to enhance solubility

      • Optimize detergent screening protocols to identify ideal solubilization conditions

      • Consider cell-free expression systems for difficult targets

  • Structural Characterization Barriers:

    • Challenge: Difficulty in obtaining high-resolution structures

    • Solutions:

      • Utilize lipid nanodiscs or amphipols to maintain native-like environment

      • Apply cryo-electron microscopy for structure determination without crystallization

      • Implement hydrogen-deuterium exchange mass spectrometry for dynamic structural information

      • Use computational modeling validated by crosslinking mass spectrometry

  • Functional Assay Limitations:

    • Challenge: Recreating membrane environment for functional studies

    • Solutions:

      • Develop proteoliposome-based assay systems with controlled lipid composition

      • Apply solid-supported membrane electrophysiology

      • Utilize fluorescence-based transport assays with reconstituted systems

      • Develop cell-based complementation assays in appropriate model organisms

  • Stability and Storage Issues:

    • Challenge: Maintaining protein stability during experimentation

    • Solutions:

      • Implement thermal shift assays to identify stabilizing buffer conditions

      • Include glycerol and specific lipids in storage buffers

      • Store at appropriate temperatures with minimal freeze-thaw cycles

      • Consider protein engineering approaches to enhance stability

By addressing these methodological challenges through systematic optimization and innovative techniques, researchers can overcome the inherent difficulties in working with membrane proteins like ccsA and generate reliable scientific insights into their structure and function .

How does ccsA function relate to the parasitic lifestyle of Cuscuta reflexa?

The relationship between ccsA function and the parasitic lifestyle of Cuscuta reflexa represents a fascinating area of research at the intersection of molecular biology and plant ecology:

Understanding the specific role of ccsA in Cuscuta reflexa's parasitic lifestyle has broader implications for comprehending the molecular basis of plant parasitism and the minimum requirements for maintaining residual photosynthetic functions in parasitic plants .

What potential biotechnological applications might arise from research on Cuscuta reflexa ccsA protein?

Research on Cuscuta reflexa ccsA protein opens several promising avenues for biotechnological applications:

  • Agricultural Innovation:

    • Development of targeted inhibitors of ccsA function as potential selective herbicides against parasitic weeds

    • Creation of engineered resistance in crop plants by modifying host factors that interact with parasite cytochrome systems

    • Design of molecular detection systems for early identification of parasitic plant infection in agricultural settings

  • Biomedical Applications:

    • The wound-healing properties observed in Cuscuta reflexa extracts may be related to redox-active components in which ccsA participates

    • Understanding cytochrome biogenesis pathways could inform development of new antimicrobials targeting similar systems in pathogenic organisms

    • The stress tolerance mechanisms of parasitic plants could inspire new approaches for tissue preservation in medical applications

  • Protein Engineering:

    • The unique features of ccsA from a parasitic context could inform the design of modified cytochrome systems with novel electron transfer properties

    • Development of biosensors based on modified cytochrome c systems for detecting specific metabolites or environmental conditions

    • Creation of synthetic biology modules incorporating ccsA for programmed electron transport functions

  • Fundamental Research Tools:

    • Engineered ccsA variants could serve as research tools for investigating cytochrome assembly in heterologous systems

    • Development of reporter systems based on cytochrome c maturation to monitor cellular redox states

    • Creation of model systems for studying evolutionary reduction of photosynthetic function

These potential applications highlight how basic research on specialized proteins from parasitic plants can lead to unexpected innovations across multiple fields .

What are common pitfalls in experimental work with recombinant ccsA protein, and how can they be addressed?

Researchers working with recombinant Cuscuta reflexa ccsA protein frequently encounter several experimental challenges that require specific troubleshooting approaches:

Common IssuePotential CausesTroubleshooting Strategies
Low expression yieldMembrane protein toxicity to host cells- Reduce induction temperature to 16-18°C
- Use specialized expression strains (C41/C43)
- Employ tightly controlled inducible promoters
Protein aggregation during purificationImproper detergent selection or concentration- Screen multiple detergents systematically
- Include glycerol (10-20%) in purification buffers
- Add specific lipids known to stabilize membrane proteins
Loss of activity during storageProtein denaturation or oxidation- Store in 50% glycerol at -20°C or -80°C
- Add reducing agents like DTT or β-mercaptoethanol
- Avoid repeated freeze-thaw cycles
Non-reproducible activity assaysVariable protein conformations- Standardize reconstitution protocols
- Control lipid composition in activity assays
- Verify protein folding before each assay series
Difficult antigenicity for antibody productionHighly conserved sequence across species- Target less conserved regions for antibody production
- Use peptide antigens from predicted exposed regions
- Consider genetic tagging approaches instead

Additionally, researchers should be aware that the full amino acid sequence contains multiple hydrophobic regions, which can complicate expression, purification, and functional analysis . When working with ccsA, it is advisable to include positive controls from well-characterized systems and to verify protein quality using multiple analytical techniques before proceeding with complex functional studies.

How can researchers address data inconsistencies when comparing ccsA function across different experimental systems?

Addressing data inconsistencies when comparing ccsA function across different experimental systems requires systematic approaches to identify and control variables:

  • Standardization of Experimental Conditions:

    • Establish common buffer systems, pH values, and ionic strengths across different experimental platforms

    • Develop standardized activity assays with well-defined endpoints and controls

    • Create reference standards for specific activities that can be used across laboratories

  • Systematic Variation Analysis:

    • Implement Design of Experiments (DoE) approaches to identify critical parameters affecting ccsA function

    • Conduct factorial experiments to detect interaction effects between experimental variables

    • Use statistical tools like ANOVA to quantify sources of variation in experimental outcomes

  • Context-Dependent Interpretation:

    • Recognize that membrane protein function is highly dependent on lipid environment and reconstitution method

    • Document and account for differences in expression systems (bacterial, insect, plant-based)

    • Develop normalization methods that account for system-specific variables

  • Technology-Specific Calibration:

    • Calibrate detection methods across different instrumental platforms

    • Establish internal controls appropriate for each experimental system

    • Validate key findings using orthogonal methodologies

  • Biological Validation:

    • Verify findings in native-like environments whenever possible

    • Use genetic complementation in relevant model systems as functional validation

    • Correlate in vitro observations with in vivo phenotypic outcomes

By implementing these strategies, researchers can distinguish genuine biological variations in ccsA function from technical artifacts and build a more coherent understanding of this protein's role across different experimental contexts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.