Recombinant Cuscuta reflexa Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Overview and Biological Context

The recombinant Cuscuta reflexa Photosystem II CP47 chlorophyll apoprotein (psbB) is a genetically engineered protein derived from the plastid-encoded psbB gene of C. reflexa, a parasitic plant in the Convolvulaceae family. This protein is a core component of the Photosystem II (PSII) complex, playing a critical role in light-driven water oxidation and electron transport in photosynthesis .

Functional Role:

  • Chlorophyll Binding: Anchors chlorophyll molecules to the PSII core, enabling light absorption .

  • Stabilization: Interacts with extrinsic proteins (e.g., PsbO) to maintain structural integrity of the OEC .

  • Electron Transfer: Participates in redox reactions critical for proton gradient formation .

Genetic and Evolutionary Context

In C. reflexa, despite parasitism and reduced photosynthetic activity, the plastid genome retains psbB and other PSII-related genes (e.g., psbA, psbD) . Comparative genomic studies reveal:

  • Gene Retention: psbB is conserved in C. reflexa and C. gronovii, unlike species like Epifagus virginiana (achlorophyllous) .

  • Sequence Homology: psbB in C. reflexa shares ~90% homology with non-parasitic plants like Nicotiana tabacum .

  • Plastid Genome Changes: Loss of ndh genes (related to chlororespiration) and pseudogenization of rpl23 and rps16 .

Biochemical and Biotechnological Relevance

  • PSII Assembly Studies: Recombinant psbB aids in reconstituting PSII core complexes to study subunit interactions .

  • Parasitic Plant Research: Provides insights into plastid genome evolution and photosynthetic retention in parasites .

  • Industrial Applications: Potential use in biotechnology for photosynthetic protein engineering .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have specific format requirements, please indicate them during order placement. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize development according to your specifications.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Cuscuta reflexa (Southern Asian dodder)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLSVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWGIAGGTVTNPGLWSYEGVAGAHIAFSGLCFLAAIWHWVYWDL EVFYDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQP IKPTWGAEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSAGLAENQSLSE TWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPIFRDNEGRELFVRRMP TFFETFPIILVDGDGIVRADVPFRRAESKYSVEQVGVTVAFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTRRQGA
Uniprot No.

Target Background

Function
CP47 is a key component of the Photosystem II (PSII) core complex. It binds chlorophyll and plays a crucial role in catalyzing the primary light-induced photochemical reactions within PSII. PSII is a light-driven water:plastoquinone oxidoreductase, utilizing light energy to extract electrons from H₂O, generating O₂ and a proton gradient that drives ATP formation.
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid membrane; Multi-pass membrane protein.

Q&A

What is the Photosystem II CP47 chlorophyll apoprotein (psbB) and what is its role in photosynthesis?

The Photosystem II CP47 chlorophyll apoprotein (psbB) is one of the core components of the photosystem II (PSII) complex, which plays a crucial role in the light-dependent reactions of photosynthesis. This protein specifically binds chlorophyll molecules and helps catalyze the primary light-induced photochemical processes of PSII . The CP47 protein serves as an internal antenna complex that captures light energy and transfers it to the reaction center where charge separation occurs. In the context of the PSII core complex, CP47 works alongside other proteins to facilitate efficient energy transfer and electron transport during photosynthesis . This protein is encoded by the psbB gene, which in many plant species, including Cuscuta reflexa, is located in the plastid genome .

How does the structure of psbB in Cuscuta reflexa differ from other photosynthetic plants?

The psbB gene in Cuscuta reflexa shows interesting structural characteristics compared to fully autotrophic plants, reflecting its parasitic lifestyle and reduced photosynthetic capacity. While Cuscuta reflexa maintains a functional psbB gene in its plastid genome, the gene may exhibit modifications that align with the plant's semi-parasitic nature . The plastid chromosome of Cuscuta reflexa follows a typical organization with a large single copy region (LSC) and a small single copy region (SSC) separated by two inverted repeat regions (IR A and IR B), but with notable differences in the sizes of these regions compared to non-parasitic plants . These differences include variations in the coding sequences and regulatory elements of photosynthesis-related genes, including psbB, which may affect protein structure and function in ways that accommodate the plant's partial dependence on host resources.

What is the significance of studying psbB protein in parasitic plants like Cuscuta reflexa?

Studying the psbB protein in Cuscuta reflexa offers unique insights into photosynthetic adaptation during the evolution of parasitism. Cuscuta species represent various stages in the progression toward total dependency on host plants, ranging from reduced photosynthetic capacity (as in C. reflexa) to complete loss of photosynthesis in some species . The maintenance of functional photosynthetic machinery, including the psbB protein, in semi-parasitic Cuscuta reflexa provides a valuable model for understanding how photosynthetic apparatus adapts during the transition to parasitism. This research contributes to our understanding of fundamental biological processes like gene retention, protein evolution, and the minimal requirements for photosynthetic function. Additionally, given the agricultural importance of Cuscuta as a substantial threat to many agroecosystems, understanding its photosynthetic machinery may provide insights for developing control strategies .

What challenges exist in expressing and purifying recombinant Cuscuta reflexa psbB protein, and how can they be overcome?

Expressing and purifying recombinant Cuscuta reflexa psbB protein presents several significant challenges due to both the nature of the protein and the characteristics of the organism. The CP47 protein is a membrane-bound protein with multiple transmembrane domains, making its expression in heterologous systems particularly difficult. Researchers can overcome these challenges by employing specialized expression systems designed for membrane proteins. Based on protocols used for similar proteins, a recommended approach would involve using an E. coli-based expression system with modifications to enhance membrane protein production . The protein should be expressed with an affinity tag, such as a His-tag, to facilitate purification as demonstrated in the expression of Welwitschia mirabilis psbB .

Additionally, expressing the protein in fragments rather than the full-length version may improve yield and solubility. For purification, a combination of detergent solubilization followed by affinity chromatography and size-exclusion chromatography typically yields the best results. The purified protein should be stored in appropriate buffer conditions with stabilizing agents such as glycerol (recommended at 5-50% final concentration) to maintain its integrity, and researchers should avoid repeated freeze-thaw cycles that could compromise protein structure .

How can researchers effectively design transformation protocols for studying psbB function in Cuscuta reflexa?

Designing effective transformation protocols for studying psbB function in Cuscuta reflexa requires addressing the notorious difficulty of transforming and regenerating this parasitic plant in vitro. A highly efficient approach exploits the unique properties of Cuscuta's infection organ (haustorium) to take up and express transgenes. Both Agrobacterium rhizogenes and Agrobacterium tumefaciens carrying binary transformation vectors with reporter fluorochromes have been demonstrated to yield high numbers of transformation events in Cuscuta reflexa . The most efficient transformation occurs in the cell layer below the adhesive disk's epidermis, suggesting these cells are particularly susceptible to infection .

For studying psbB function specifically, researchers should design transformation vectors containing either modified versions of the psbB gene or regulatory elements that affect its expression, coupled with reporter genes such as fluorescent proteins to track transformation success. Co-transformation approaches can be particularly valuable, as Cuscuta reflexa cells readily accept multiple constructs when different Agrobacterium strains carrying various constructs are applied together . To maintain transformed tissue, explants should be cultured in vitro, where they can express the fluorescent markers for several weeks, potentially allowing for development of transformed cells into callus . This protocol provides a powerful platform for functional analysis of psbB and other genes involved in photosynthesis and host interaction in this challenging parasitic plant system.

What methods are most effective for analyzing the interaction between recombinant psbB protein and other components of the photosystem II complex?

Analyzing interactions between recombinant psbB protein and other photosystem II components requires sophisticated biochemical and biophysical approaches. A multi-faceted strategy is recommended for comprehensive characterization. Co-immunoprecipitation (Co-IP) using antibodies specific to the CP47 protein or its interaction partners can identify protein-protein interactions in native or near-native conditions. The availability of antibodies against the CP47 subunit, such as those used for Arabidopsis thaliana and other plant species, facilitates this approach .

For detailed structural analysis, researchers should consider cryo-electron microscopy or X-ray crystallography of the purified complexes, though these techniques present significant challenges for membrane protein complexes. Cross-linking mass spectrometry (XL-MS) offers a powerful alternative, where chemical cross-linkers stabilize transient or weak interactions before mass spectrometric analysis. Blue native polyacrylamide gel electrophoresis (BN-PAGE) followed by second-dimension SDS-PAGE can separate intact complexes and then identify individual components, providing insights into complex formation and stability.

Functional assays measuring electron transport rates, oxygen evolution, or fluorescence characteristics in reconstituted systems containing wild-type or modified recombinant psbB can reveal the functional consequences of specific interactions. For in vivo validation of interactions identified in vitro, bimolecular fluorescence complementation (BiFC) or Förster resonance energy transfer (FRET) techniques can be adapted for use in the Cuscuta transformation system described previously .

What protein extraction and purification protocols are optimal for obtaining functional psbB protein from Cuscuta reflexa?

Extracting and purifying functional psbB protein from Cuscuta reflexa requires specialized protocols that account for the membrane-bound nature of this chlorophyll-binding protein. The optimal extraction procedure begins with fresh Cuscuta reflexa tissue, preferably stems with residual photosynthetic capacity. Tissue should be flash-frozen in liquid nitrogen and ground to a fine powder using a mortar and pestle. A gentle extraction buffer containing 50 mM Tris-HCl (pH 7.5), 100 mM NaCl, 5 mM MgCl2, and 10% glycerol, supplemented with protease inhibitors, should be used for initial homogenization. The critical step involves solubilization of membrane proteins using appropriate detergents; a combination of 1% n-dodecyl β-D-maltoside (DDM) and 0.5% sodium cholate has proven effective for similar photosystem components .

Following centrifugation to remove insoluble material, the solubilized proteins can be purified using a combination of techniques. For native psbB protein, sucrose density gradient ultracentrifugation followed by anion exchange chromatography effectively separates photosystem complexes. If working with tagged recombinant versions, affinity chromatography (e.g., using Ni-NTA for His-tagged proteins) provides a powerful initial purification step . Size exclusion chromatography serves as an excellent final purification step, allowing separation of intact complexes from free proteins. Throughout the purification process, it is essential to maintain a cold temperature (4°C) and include stabilizing agents like glycerol in all buffers. The purified protein should be assessed for functionality through chlorophyll binding assays and spectroscopic analysis to confirm proper folding and pigment incorporation.

How can researchers accurately assess the photosynthetic efficiency of recombinant psbB in experimental systems?

Accurately assessing the photosynthetic efficiency of recombinant psbB requires a multi-parameter approach combining biophysical, biochemical, and functional measurements. Chlorophyll fluorescence analysis serves as a cornerstone technique, particularly pulse-amplitude modulation (PAM) fluorometry, which can determine key parameters including maximum quantum yield (Fv/Fm), effective quantum yield (ΦPSII), and non-photochemical quenching (NPQ). These measurements directly reflect PSII functionality where the psbB protein plays a crucial role. Oxygen evolution measurements using a Clark-type electrode provide a direct quantification of PSII activity, measuring the rate of oxygen production under controlled light conditions in isolated thylakoid membranes or reconstituted systems containing the recombinant protein.

P700 absorbance changes (measured at 830 nm) can assess electron flow through PSI, providing information about the entire electron transport chain functionality. Thermoluminescence measurements offer insights into charge recombination events within PSII, reflecting the energetic properties of the electron transfer processes. For in vivo assessments in transformed Cuscuta tissues, researchers should measure the relative electron transport rate (rETR) using PAM fluorometry under various light intensities to generate rapid light response curves. Additionally, researchers should compare these parameters between wild-type and recombinant systems, and under various stress conditions, to fully characterize the functional impact of the recombinant psbB protein on photosynthetic performance.

What protocols can be used to analyze the chlorophyll-binding properties of recombinant psbB protein?

The analysis of chlorophyll-binding properties of recombinant psbB protein requires specialized techniques that preserve the native interaction between the protein and its pigment molecules. Absorption spectroscopy provides fundamental information about the chlorophyll binding status, with peaks at approximately 440 nm and 680 nm indicating properly bound chlorophyll a molecules. Circular dichroism (CD) spectroscopy in the visible region (400-700 nm) offers valuable insights into the arrangement and interaction of chlorophyll molecules within the protein structure. Researchers should perform titration experiments where purified psbB protein is incubated with increasing concentrations of chlorophyll in appropriate detergent-containing buffer, followed by analysis using fluorescence spectroscopy to determine binding constants and stoichiometry.

For detailed characterization, resonance Raman spectroscopy can provide information about the vibrational modes of bound chlorophyll molecules, reflecting their exact binding environment. Size exclusion chromatography coupled with pigment analysis allows separation of chlorophyll-bound and unbound protein fractions, providing quantitative data on binding capacity. Following purification, bound chlorophylls can be extracted using organic solvents (acetone/methanol) and quantified by high-performance liquid chromatography (HPLC). Additionally, researchers should consider reconstitution experiments where the purified apoprotein is incubated with chlorophyll under varying conditions to determine factors affecting binding efficiency, including pH, ionic strength, and presence of specific lipids or detergents that may facilitate proper protein folding and chlorophyll incorporation.

How can recombinant Cuscuta reflexa psbB be used to investigate parasitic plant evolution and adaptation?

Recombinant Cuscuta reflexa psbB serves as a powerful tool for investigating the evolutionary trajectory of parasitic plants and their photosynthetic adaptations. By comparing the structure, function, and regulation of this protein between Cuscuta reflexa and non-parasitic relatives, researchers can identify specific molecular changes associated with the transition to parasitism. Functional studies using recombinant psbB variants can help determine which alterations represent adaptive changes versus incidental mutations, providing insights into the selective pressures driving parasitic plant evolution. Cuscuta species represent various stages in the progression toward total dependency on host plants, making them excellent models for studying this evolutionary trajectory .

Transformation systems utilizing recombinant psbB constructs allow for in vivo manipulation of photosynthetic capacity in Cuscuta, enabling researchers to test hypotheses about the minimum photosynthetic requirements for survival in these partial parasites . Complementation studies in which Cuscuta psbB is expressed in other plant systems (or vice versa) can reveal functional divergence and potentially identify novel properties that have evolved in the parasitic context. The plastid genome organization in Cuscuta reflexa, while maintaining the typical structure with LSC, SSC, and IR regions, shows significant size variations compared to predictions, highlighting the value of detailed sequence analysis over hybridization studies in understanding genomic adaptation . This research contributes not only to our understanding of parasitic plant biology but also provides broader insights into the evolution of photosynthesis and plant-plant interactions.

What potential applications exist for understanding psbB function in developing control strategies for parasitic Cuscuta species?

Understanding psbB function in Cuscuta species offers several promising avenues for developing targeted control strategies for these agricultural parasites. Since Cuscuta reflexa maintains photosynthetic capacity, albeit reduced, interfering with its photosynthetic machinery through specific inhibitors targeting unique features of its psbB protein could provide selective control without harming host crops. The transformation protocol utilizing Agrobacterium-mediated gene delivery to the infection organ cells creates opportunities for developing novel biocontrol approaches . Researchers could exploit this system to introduce constructs that interfere with psbB expression or function specifically when the parasite attempts to establish contact with host plants.

RNA interference (RNAi) or CRISPR-based approaches targeting unique sequences in the Cuscuta psbB gene could be developed and delivered through engineered host plants, potentially disrupting the parasite's residual photosynthetic capacity at critical developmental stages. Understanding the regulation of psbB in response to successful host parasitization might reveal time points of particular vulnerability where the parasite relies more heavily on its own photosynthesis. Comparative analysis of psbB function across Cuscuta species with varying degrees of photosynthetic capacity could identify evolutionary trends that predict which agricultural parasites are more likely to develop complete host dependency, informing long-term management strategies. The knowledge generated through these approaches contributes to sustainable agricultural practices by enabling more targeted and environmentally friendly control measures for these significant crop parasites .

How might recombinant psbB protein be utilized in studying the medicinal properties of Cuscuta reflexa?

Recombinant psbB protein offers a novel avenue for investigating the relationship between photosynthetic capacity and the medicinal properties of Cuscuta reflexa. This parasitic plant has demonstrated numerous beneficial properties, including antiepileptic, antitumor, anti-inflammatory, anticancer, antibacterial, antiviral, and antioxidant activities . Researchers can use recombinant psbB and associated transformation systems to manipulate photosynthetic capacity in Cuscuta and examine how changes in photosynthetic function affect the plant's secondary metabolite profile, potentially identifying correlations between specific photosynthetic parameters and the production of therapeutic compounds.

The phytochemical investigation of Cuscuta reflexa has identified important flavonoids, including Isorhamnetin, Isorhamnetin-3-O-glucoside, and Isorhamnetin-3-O-robinobioside, which contribute to its medicinal properties, particularly its significant antimutagenic activity against various genotoxic compounds . By creating Cuscuta lines with modified psbB expression or function, researchers can determine whether alterations in photosynthetic capacity influence the biosynthesis of these beneficial compounds. Metabolomic analysis comparing wild-type and psbB-modified Cuscuta could reveal previously unrecognized connections between primary metabolism (photosynthesis) and secondary metabolism (medicinal compounds). Furthermore, since many therapeutic plant compounds act as antioxidants, understanding how modifications to the photosynthetic apparatus (a major source of reactive oxygen species in plants) affect the plant's antioxidant systems could provide insights into the molecular basis of Cuscuta's medicinal properties and potentially lead to enhanced production of beneficial compounds.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.