Recombinant Cuscuta reflexa Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Cuscuta reflexa Photosystem Q(B) Protein

The Recombinant Cuscuta reflexa Photosystem Q(B) protein (PsbA) is a genetically engineered version of the D1 protein subunit of Photosystem II (PSII), a critical component in the photosynthetic electron transport chain. This protein is derived from Cuscuta reflexa (Southern Asian dodder), a parasitic plant in the Convolvulaceae family. Produced in Escherichia coli with a His-tag for purification, the recombinant protein retains functional and structural properties of the native protein, enabling studies on photosynthetic mechanisms, host-parasite interactions, and molecular evolution .

Production and Purification

  • Expression System: Optimized codon usage for high-yield expression in E. coli .

  • Purification: Immobilized metal-affinity chromatography (IMAC) via His-tag .

  • Reconstitution: Lyophilized powder reconstituted in Tris/PBS buffer (pH 8.0) with glycerol for stability .

Role in Parasitism

  • Cuscuta reflexa relies on host plants for nutrients but retains a vestigial photosynthetic apparatus. The PsbA protein is under strong evolutionary constraint despite gene losses in related Cuscuta species .

  • Comparative studies show C. reflexa retains psbA and other PSII genes, unlike non-photosynthetic parasites like Epifagus virginiana, which lack photosynthetic genes entirely .

Host Recognition Mechanism

  • The C. reflexa glycine-rich protein (CrGRP), a cell wall-associated peptide containing the CrCrip21 motif, interacts with the tomato receptor CuRe1 to trigger host immune responses (e.g., ethylene production) .

  • CrCrip21 (21-amino-acid cysteine-rich peptide) activates CuRe1 at nanomolar concentrations, highlighting its role in plant-pathogen-like interactions .

Comparative Analysis with Tomato PsbA

FeatureCuscuta reflexa PsbASolanum lycopersicum PsbA
UniProt IDP32036Q2MIC0
Sequence Length343 residues343 residues
Key ModificationsReduced photosynthetic activityFully functional in PSII
Expression HostE. coliE. coli
Conservation78% identity with tomato PsbABaseline for photosynthetic studies .

Research Applications

  1. Photosynthetic Adaptation Studies: Investigate gene retention patterns in parasitic plants .

  2. Host-Parasite Interaction Models: Study CrGRP-mediated immune activation using recombinant PsbA .

  3. Protein Engineering: Optimize PSII stability under stress conditions (e.g., high light, drought) .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order, and we will accommodate your needs.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing it accordingly.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-344
Protein Length
Full Length of Mature Protein
Species
Cuscuta reflexa (Southern Asian dodder)
Target Names
psbA
Target Protein Sequence
TAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDID GIREPVSGSLLYGNNIVSGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFLL GVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFN FMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFGQ EEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGFN FNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H2O, generating O2 and a proton gradient subsequently used for ATP formation. It comprises a core antenna complex that captures photons and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, as well as several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid membrane; Multi-pass membrane protein.

Q&A

What is the Photosystem Q(B) protein in Cuscuta reflexa and how does it differ from other plants?

The Photosystem Q(B) protein in Cuscuta reflexa functions as part of the electron transport chain in Photosystem II, binding plastoquinone and facilitating electron transfer during photosynthesis. Unlike autotrophic plants, C. reflexa as a holoparasite shows reduced photosynthetic capability, which affects the structure and function of its photosystem components. Research indicates that C. reflexa must maintain some photosynthetic machinery despite obtaining most nutrients from host plants through haustoria . Experimental approaches to study these differences include comparative proteomic analysis, spectroscopic measurements of electron transport efficiency, and structural biology techniques to resolve protein architecture.

How can Photosystem Q(B) protein be isolated from Cuscuta reflexa tissue?

Isolation of Photosystem Q(B) protein from C. reflexa requires specialized protocols due to its parasitic lifestyle. The protein can be extracted from stem tissue (C. reflexa lacks true leaves) using thylakoid membrane isolation procedures followed by detergent solubilization and chromatographic separation. For optimal yields, C. reflexa should be collected during active growth on a compatible host plant . Researchers should consider the developmental stage of the parasite and its photosynthetic status, as protein expression may vary depending on host attachment and environmental conditions. Purification typically employs ion exchange chromatography followed by size exclusion techniques under conditions that preserve protein structure and function.

What expression systems are most effective for producing recombinant Cuscuta reflexa Photosystem Q(B) protein?

The most effective heterologous expression systems for recombinant C. reflexa Photosystem Q(B) protein include modified E. coli strains optimized for membrane protein expression, insect cell systems (particularly Sf9 cells), and plant-based expression platforms. Each system offers distinct advantages:

Expression SystemAdvantagesChallengesTypical Yield
E. coliRapid growth, simple geneticsMay lack proper folding machinery1-5 mg/L culture
Insect cellsPost-translational modificationsHigher cost, longer production time5-10 mg/L culture
Plant-basedNative-like processingLower yield, longer production time0.5-2 mg/g fresh weight

Success in expression requires optimizing codon usage for the host organism and including purification tags that don't interfere with protein folding or function . When working with this challenging membrane protein, detergent screening is crucial for maintaining stability during purification.

What are the challenges in determining the three-dimensional structure of recombinant Cuscuta reflexa Photosystem Q(B) protein?

Determining the three-dimensional structure of recombinant C. reflexa Photosystem Q(B) protein faces multiple challenges:

  • Membrane protein crystallization issues, including detergent selection that maintains native conformation

  • Low expression yields limiting material for structural studies

  • Potential structural flexibility affecting cryo-EM resolution

  • Parasitic adaptations potentially causing structural differences from model systems

Methodological approaches to overcome these challenges include:

  • Lipidic cubic phase crystallization specifically optimized for photosystem proteins

  • Nanodiscs to maintain native-like lipid environments during structure determination

  • Cross-linking mass spectrometry to determine proximity relationships between protein domains

  • Computational modeling validated with limited experimental constraints

Success requires iterative optimization of protein stability conditions and extensive screening of crystallization parameters . Recent advances in AlphaFold predictions may provide initial models that can be refined with experimental data.

How does the electron transport function of Photosystem Q(B) protein in Cuscuta reflexa compare to that in photosynthetically active plants?

The electron transport function of Photosystem Q(B) protein in C. reflexa shows significant adaptations compared to photosynthetically active plants. Research indicates that despite reduced photosynthetic capability, C. reflexa maintains functional electron transport chains but with modified efficiency. Experimental measurements using oxygen evolution analysis, chlorophyll fluorescence, and electron paramagnetic resonance spectroscopy reveal:

  • Altered plastoquinone binding kinetics in the QB pocket

  • Modified redox potential optimized for partial photosynthetic activity

  • Unique non-photochemical quenching (NPQ) characteristics that may reflect adaptation to parasitism

Methodologically, researchers should employ pulse amplitude modulated fluorometry to measure effective quantum yield while simultaneously monitoring plastoquinone redox state. Comparative analysis with closely related autotrophic species provides crucial context for understanding the parasitic adaptation of this protein.

What role might Photosystem Q(B) protein play in haustorium development or function in Cuscuta reflexa?

The Photosystem Q(B) protein may have unexpected roles in haustorium development or function in C. reflexa beyond its classical photosynthetic electron transport function. Recent research suggests potential involvement in:

  • Redox signaling during haustorium initiation in response to host detection

  • Energy production during early haustorium development before vascular connection establishment

  • Possible moonlighting functions related to host-parasite molecular communication

Methodological approaches to investigate these roles include:

  • Temporal proteomic analysis during haustorium development stages

  • Localization studies using fluorescently tagged recombinant proteins

  • Targeted gene silencing using host-induced gene silencing (HIGS) approaches

The initiation of haustorium development in C. reflexa is triggered by far-red light and mechanical stimulation, suggesting involvement of phytochrome signaling pathways that may interact with photosystem components . Researchers should examine protein expression patterns during the four stages of haustorium development: initiation, adhesion, penetration, and vascular connection.

What site-directed mutagenesis approaches are most informative for studying Cuscuta reflexa Photosystem Q(B) protein function?

Site-directed mutagenesis of C. reflexa Photosystem Q(B) protein provides valuable insights into structure-function relationships. The most informative approaches target:

  • Conserved amino acids in the plastoquinone binding pocket

  • Interface residues that interact with other photosystem components

  • Regions showing parasitic plant-specific sequence divergence

Methodologically, researchers should:

  • Create an alignment-guided mutation strategy based on comparison with well-characterized photosystem proteins

  • Use alanine-scanning mutagenesis of the QB binding pocket

  • Employ charge-swap mutations to test electrostatic interactions

  • Design chimeric constructs swapping domains with photosynthetically active plants

Functional assessment of mutants requires a combination of biochemical assays (oxygen evolution, electron transport rates) and biophysical techniques (fluorescence spectroscopy, EPR) . Expression in model systems like Synechocystis allows for complementation studies against well-characterized knockout backgrounds.

How can isotope labeling be utilized to study the dynamics of Cuscuta reflexa Photosystem Q(B) protein?

Isotope labeling provides powerful tools for studying the dynamics of C. reflexa Photosystem Q(B) protein across multiple timescales. Effective approaches include:

  • 15N/13C labeling for NMR studies:

    • Enables residue-specific analysis of protein dynamics

    • Requires expression in minimal media with labeled nitrogen and carbon sources

    • Most effective when focused on specific domains rather than the entire protein

  • Deuterium labeling for hydrogen-deuterium exchange mass spectrometry:

    • Reveals solvent-accessible regions and conformational changes

    • Particularly valuable for mapping plastoquinone-induced structural changes

    • Can be performed on partially purified protein preparations

  • Pulse-chase labeling with 35S-methionine:

    • Tracks protein synthesis and turnover during parasite development

    • Particularly informative when comparing protein dynamics before and after host attachment

Methodologically, researchers must optimize growth conditions for incorporation of isotopes while maintaining protein folding and function. Data analysis requires specialized software to interpret complex NMR spectra or mass spectrometry datasets in the context of structural models.

How has the Photosystem Q(B) protein evolved in Cuscuta reflexa compared to other parasitic and non-parasitic plants?

Evolutionary analysis of the Photosystem Q(B) protein in C. reflexa reveals significant adaptations compared to both non-parasitic plants and other parasitic species. Research methodologies to investigate this evolution include:

  • Phylogenetic analysis using maximum likelihood and Bayesian approaches

  • Selection pressure analysis (dN/dS ratios) to identify positively selected residues

  • Ancestral sequence reconstruction to map evolutionary trajectories

  • Structural modeling to understand the functional consequences of sequence changes

Studies show that despite reduced photosynthetic activity, C. reflexa maintains functional photosystem components with specific adaptations . The methodological approach should include comparison with both close relatives in Convolvulaceae and other parasitic lineages that evolved independently (convergent evolution). Special attention should be paid to regions involved in protein-protein interactions and regulatory domains that might reflect adaptation to the parasitic lifestyle.

What is the relationship between Photosystem Q(B) protein function and the glycine-rich protein (GRP) that triggers host immune responses?

The relationship between Photosystem Q(B) protein function and the glycine-rich protein (GRP) that triggers host immune responses represents an intriguing area of research. While these proteins have distinct primary functions, several potential connections warrant investigation:

  • Possible co-regulation during host attachment and infection

  • Shared subcellular localization pathways during haustorium development

  • Potential evolutionary relationship or domain sharing

Methodologically, researchers should employ:

  • Co-immunoprecipitation to detect physical interactions

  • Transcriptomic analysis to identify co-expression patterns

  • Fluorescence co-localization studies during different infection stages

The GRP acts as a pathogen-associated molecular pattern (PAMP) recognized by the host's CuRe1 receptor, triggering defense responses . Understanding whether photosystem components like the Q(B) protein interact with this system could reveal novel aspects of host-parasite co-evolution.

What are the most effective approaches for measuring binding affinities between recombinant Cuscuta reflexa Photosystem Q(B) protein and electron transport chain components?

Measuring binding affinities between recombinant C. reflexa Photosystem Q(B) protein and electron transport chain components requires specialized techniques due to the membrane-embedded nature of these interactions. The most effective approaches include:

TechniquePrincipleAdvantagesLimitations
Microscale ThermophoresisMeasures changes in thermophoretic mobility upon bindingWorks with membrane proteins, low sample consumptionRequires fluorescent labeling
Surface Plasmon ResonanceDetects mass changes upon binding to immobilized proteinReal-time kinetics, label-freeChallenge to immobilize membrane proteins properly
Isothermal Titration CalorimetryMeasures heat changes during bindingDirect measurement of thermodynamic parametersHigh protein consumption, lower sensitivity
Fluorescence AnisotropyMeasures changes in rotational diffusion upon bindingWorks in solution, good for small ligandsRequires fluorescent labeling

Methodologically, researchers must carefully select detergents or nanodiscs that maintain protein function while allowing detection of specific interactions . Binding studies should be performed at physiologically relevant temperatures with proper controls for non-specific interactions.

How can transcriptomic and proteomic approaches be integrated to study Photosystem Q(B) protein expression during different stages of Cuscuta reflexa infection?

Integrating transcriptomic and proteomic approaches provides comprehensive insights into Photosystem Q(B) protein expression during different stages of C. reflexa infection. An effective integrated methodology includes:

  • Sample collection strategy:

    • Collect C. reflexa tissue at defined infection stages: pre-attachment, early haustorium formation, mature haustorium, and established connection

    • Include samples from different host plants to identify host-specific regulation

  • Multi-omics workflow:

    • RNA-seq with strand-specific library preparation

    • Parallel proteomics using both shotgun and targeted approaches

    • Phosphoproteomics to identify regulatory events

    • Metabolomics focusing on photosynthetic intermediates

  • Data integration framework:

    • Correlation analysis between transcript and protein levels

    • Pathway enrichment accounting for temporal dynamics

    • Network analysis to identify co-regulated genes

    • Validation of key findings with targeted approaches (RT-qPCR, Western blot)

Special consideration should be given to the haustorium development stages, as the transition from autotrophic to heterotrophic nutrition may involve significant remodeling of photosynthetic machinery . For protein extraction, researchers must optimize protocols to handle both soluble and membrane-bound photosystem components.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.