Recombinant Cuscuta reflexa Plastid envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Description

General Information

Cuscuta, commonly known as dodder, is a genus of parasitic plants that rely on host plants for survival . As a parasite, Cuscuta has undergone evolutionary changes, including modifications to its plastid genome . Plastids are plant cell organelles responsible for various functions, including photosynthesis and the synthesis of essential metabolites . The plastid envelope membrane, which surrounds the plastid, contains proteins like cemA that play a crucial role in plastid function .

Function and Characteristics

  • Membrane Transport: CemA proteins are integral membrane proteins, suggesting their involvement in transporting molecules across the plastid envelope . This transport is vital for importing essential metabolites and exporting synthesized compounds .

  • Plastid Biogenesis and Development: As a component of the plastid envelope, cemA may participate in the biogenesis and development of plastids .

  • Adaptation to Parasitism: Given Cuscuta's parasitic lifestyle and the reduction of its plastid genome, cemA might be involved in processes that compensate for the loss of photosynthetic function . This could include the import of nutrients from the host plant or the modification of metabolic pathways within the plastid.

Evolutionary Context

The evolution of plastid genomes in parasitic plants like Cuscuta is marked by gene loss and horizontal gene transfer events . The loss of genes related to photosynthesis is common, while some essential "housekeeping" genes are retained . In some instances, genetic material is acquired from host plants .

Recombinant Production

Recombinant cemA refers to the protein produced using recombinant DNA technology. This involves introducing the gene encoding cemA into a host organism (e.g., E. coli) and expressing the protein . Recombinant cemA can be used for various research purposes, such as studying its structure, function, and interactions with other proteins .

Table: Properties of Recombinant Nephroselmis olivacea cemA Protein (Note: Information is based on a related species due to limited data on Cuscuta reflexa)

PropertyDescription
SpeciesNephroselmis olivacea (Green alga)
SourceE. coli
TagHis
Protein LengthFull Length (1-392 amino acids)
FormLyophilized powder
PurityGreater than 90% as determined by SDS-PAGE
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding 5-50% of glycerol (final concentration) and aliquot for long-term storage.
Gene NamecemA
SynonymscemA; Chloroplast envelope membrane protein
UniProt IDQ9TKZ2

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cemA; Plastid envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Cuscuta reflexa (Southern Asian dodder)
Target Names
cemA
Target Protein Sequence
MAKKKAFSPIFHLSFIVFLPWGIYLSFKKCLGSWITNWWNTSESEIFLNIIQEKSILENF IELEEFLFVEEIFKNNSETHPQEFHTGIHKEAIQFIKIQNESYIHMILRLSTNLICVVII SGFYIWRNETLVILNSWSREFLYNLSDTVKVFSILLLTDLCIGFHSPHGWELMIGSIYKD FGFVQNDRIISGLVSTFPVILDTIFKYWIFRYLNRVSPSLVVIYHSMND
Uniprot No.

Target Background

Function
This protein may be involved in proton extrusion and indirectly facilitates efficient inorganic carbon uptake into plastids.
Protein Families
Cema family
Subcellular Location
Plastid membrane; Multi-pass membrane protein.

Q&A

How does the chloroplast genome of Cuscuta reflexa differ from other plants?

Cuscuta reflexa exhibits distinctive chloroplast genome characteristics that reflect its parasitic lifestyle:

  • IR expansion: The ycf2 gene crosses the LSC/IRb region in Cuscuta reflexa, with 3,519 bp extending into the LSC region, which differs from other Cuscuta species .

  • SSR distribution: Cuscuta reflexa contains 36 simple sequence repeats (SSRs) in its chloroplast genome, predominantly mononucleotide repeats of A or T types, as shown in this comparative table:

SpeciesTotal SSRsDinucleotide RepeatsMononucleotide A (10-12+)Mononucleotide T (10-12+)
C. reflexa3649+3+3+27+3+4+1
C. japonica2104+3+0+07+6+1+0
C. nitida46213+5+2+67+2+1+8
  • Phylogenetic position: Cuscuta reflexa belongs to the subgenus Monogynella, which retains more chloroplast genes compared to other more reduced parasitic Cuscuta species .

What are the recommended methods for producing recombinant cemA protein from Cuscuta reflexa?

For successful production of recombinant cemA protein from Cuscuta reflexa, researchers should follow these methodological steps:

  • Gene isolation: Extract total DNA from fresh C. reflexa tissue, amplify the cemA coding region using PCR with gene-specific primers designed from the known sequence (positions 1-229) .

  • Expression vector construction: Clone the amplified cemA gene into an appropriate expression vector with a well-characterized tag for purification.

  • Expression system: Use a prokaryotic (E. coli) or eukaryotic (insect cells or yeast) expression system depending on research needs. For membrane proteins like cemA, consider systems that facilitate proper folding.

  • Purification protocol: Utilize affinity chromatography based on the included tag, followed by size exclusion chromatography.

  • Storage conditions: Store the purified protein in Tris-based buffer with 50% glycerol at -20°C for short-term use or -80°C for extended storage. Working aliquots may be stored at 4°C for up to one week .

  • Quality control: Verify protein identity and purity using SDS-PAGE, Western blot, and mass spectrometry.

How can transformation protocols be optimized for studying cemA function in Cuscuta reflexa?

Cuscuta reflexa transformation presents unique challenges due to its parasitic nature. Based on recent advances, researchers should consider:

  • Adhesive disk transformation: Target the adhesive disks of C. reflexa for transformation, as they have shown high propensity to take up and express transgenes. This approach yields hundreds of transformed cells within a week .

  • Agrobacterium selection: Both A. rhizogenes and A. tumefaciens have demonstrated high transformation efficiency. For cemA functional studies, A. tumefaciens may be preferable for its versatility in accepting larger constructs .

  • Developmental timing: Transformation efficiency is heavily dependent on the developmental stage of the infection organ. Uptake of T-DNA appears minimal in the first 2 days and increases significantly once infection site development commences .

  • Haustoriogenesis induction: Use a combination of far-red light illumination and tactile stimuli to synchronize haustorial development before Agrobacterium exposure, following the method described by Olsen et al. (2016) .

  • Reporter system optimization: When investigating cemA localization or interaction, fluorescent protein markers should be selected that don't interfere with the natural green and blue autofluorescence observed in central haustorial tissue .

  • Co-transformation strategies: Utilize the capacity for cotransformation of different constructs to perform protein interaction studies or complementation assays for cemA functional analysis .

What approaches can be used to investigate the role of cemA in the parasitic lifestyle of Cuscuta reflexa?

To elucidate cemA's role in Cuscuta reflexa's parasitism, researchers should employ these methodological approaches:

  • CRISPR/Cas9 gene editing: Despite transformation challenges, CRISPR technology can be adapted to create cemA knockout or modified lines in C. reflexa, targeting the adhesive disk cells for transformation .

  • Transcriptomic analysis: Compare cemA expression levels between parasitic and non-parasitic tissues, and during different stages of host attachment and nutrient acquisition.

  • Proteomics approach: Use co-immunoprecipitation with labeled recombinant cemA to identify interacting proteins in both Cuscuta and host plants.

  • Heterologous expression: Express C. reflexa cemA in model plant systems to examine if it confers any altered host recognition capabilities.

  • Comparative genomics: Analyze cemA sequence variations across different Cuscuta species with varying degrees of parasitism to identify correlation between sequence features and parasitic behaviors .

  • Interspecies chimeric constructs: Create chimeric cemA proteins with domains from parasitic and non-parasitic plants to identify regions responsible for parasitism-specific functions.

What contradictions exist in current research regarding cemA function in parasitic plants like Cuscuta reflexa?

Several contradictions and knowledge gaps exist in current research on cemA in parasitic plants:

  • Plastid function paradox: While most photosynthetic genes are lost or pseudogenized in parasitic plants, cemA is retained in Cuscuta reflexa despite reduced photosynthetic capacity, suggesting an alternative non-photosynthetic function .

  • Transcription apparatus inconsistency: Research indicates that genes encoding plastid RNA polymerase subunits (rpoA, rpoC1) are lost or pseudogenized (rpoB, rpoC2) in Cuscuta species, raising questions about how cemA transcription is regulated in these plants .

  • Evolutionary conservation discrepancy: The retention of cemA, along with accD, clpP, ycf1 and ycf2, in parasitic plants with reduced plastomes suggests these genes provide essential functions beyond photosynthesis, but their exact roles remain poorly characterized .

  • Host-parasite interaction conflict: The role of cemA in host-parasite interactions remains unclear, with some studies suggesting involvement in nutrient acquisition while others indicate potential roles in evading host defense mechanisms.

  • Methodological limitations: Current transformation protocols show high efficiency for adhesive disk cells but have not been successfully extended to stable transgenic line development, limiting long-term functional studies .

How should researchers design quasi-experimental approaches to study cemA function in field conditions?

When designing quasi-experimental studies for cemA function in field conditions, researchers should consider:

  • Control selection framework: Implement rigorous counterfactual frameworks such as matching, difference-in-differences (DiD), or regression discontinuity designs to mitigate selection bias when comparing wild-type and cemA-modified Cuscuta on various hosts .

  • Effect size calculation: Quantify cemA function effects using the formula:

    Effect Size = (Outcome in Treatment Group - Outcome in Control Group) / Standard Deviation

  • Validity assurance: Enhance internal validity through:

    • Careful selection of control and experimental sites

    • Standardization of environmental conditions

    • Comprehensive documentation of potential confounding variables

  • Host range testing: Test cemA function across multiple host species simultaneously to identify host-specific effects versus conserved functions.

  • Temporal design considerations: Implement time-series measurements to capture developmental and seasonal variations in cemA activity.

  • Mixed-methods approach: Combine molecular data collection with physiological measurements to correlate cemA expression with observable parasitic behaviors.

What are the recommended assay designs for studying protein-protein interactions involving cemA?

To effectively study protein-protein interactions involving the cemA protein, researchers should employ these methodological approaches:

  • Yeast two-hybrid screening:

    • Clone the cemA gene into bait vector

    • Screen against prey libraries from both Cuscuta reflexa and potential host plants

    • Validate positive interactions through secondary screening

    • Identify interaction domains through deletion series

  • Pull-down assays with recombinant cemA:

    • Express recombinant cemA with affinity tags (His, GST, etc.)

    • Prepare protein extracts from haustorium tissue at different developmental stages

    • Perform pull-down and identify binding partners via mass spectrometry

    • Confirm interactions through reciprocal pull-downs

  • Bimolecular Fluorescence Complementation (BiFC):

    • Utilize the transformation protocol targeting adhesive disks

    • Fuse cemA and candidate interactors with split fluorescent protein fragments

    • Observe interaction in vivo during host attachment process

    • Document spatial and temporal aspects of interactions

  • Co-immunoprecipitation from transformed haustoria:

    • Take advantage of the highly efficient transformation of adhesive disks

    • Express tagged versions of cemA

    • Perform IP followed by proteomics analysis

    • Compare interactome between different developmental stages

  • Surface Plasmon Resonance (SPR):

    • Purify recombinant cemA protein

    • Analyze binding kinetics with candidate interactors

    • Determine binding affinities and association/dissociation rates

How can researchers design experiments to determine the subcellular localization and trafficking of cemA in Cuscuta reflexa?

For determining cemA subcellular localization and trafficking in Cuscuta reflexa, researchers should implement:

  • Fluorescent protein fusion constructs:

    • Generate N- and C-terminal GFP/RFP fusions with cemA

    • Transform adhesive disks using the protocol developed by Olsen et al.

    • Use confocal microscopy to visualize localization

    • Be mindful of the natural green and blue autofluorescence observed in central haustorial tissue

  • Immunogold electron microscopy:

    • Develop specific antibodies against C. reflexa cemA

    • Perform immunogold labeling on embedded haustorium sections

    • Use transmission electron microscopy for high-resolution localization

  • Subcellular fractionation:

    • Separate organelles from Cuscuta tissue at different developmental stages

    • Perform Western blots with anti-cemA antibodies

    • Compare protein distribution between fractions

    • Include appropriate markers for different compartments

  • Photoactivatable fluorescent protein assays:

    • Fuse cemA with photoactivatable proteins

    • Activate fluorescence in specific cellular regions

    • Track protein movement over time

    • Determine trafficking rates and directionality

  • FRAP (Fluorescence Recovery After Photobleaching):

    • Express cemA-GFP fusion in transformed adhesive disks

    • Photobleach specific regions

    • Measure fluorescence recovery

    • Calculate protein mobility parameters

What are the main limitations in purifying and stabilizing recombinant cemA for structural studies?

Researchers face several challenges when purifying and stabilizing recombinant cemA:

  • Membrane protein instability: As a plastid envelope membrane protein, cemA is inherently difficult to solubilize and maintain in native conformation outside the membrane environment.

  • Expression system selection: Bacterial expression systems may fail to provide the correct folding environment, while eukaryotic systems add complexity but might improve protein quality.

  • Detergent optimization: Finding the optimal detergent or lipid nanodisc composition that maintains cemA stability requires extensive screening:

    Detergent ClassAdvantagesDisadvantages
    Ionic (SDS)Effective solubilizationOften denatures protein
    Non-ionic (DDM)Milder, preserves activityLess efficient extraction
    Zwitterionic (CHAPS)Balance of extraction & stabilityBuffer-dependent performance
    Lipid nanodiscsNative-like environmentComplex preparation
  • Purification yield optimization: The recommended storage in Tris-based buffer with 50% glycerol suggests stability issues that may limit yield during purification.

  • Post-translational modifications: Potential PTMs in native cemA may not be replicated in recombinant systems, affecting protein function and stability.

  • Crystallization challenges: Membrane proteins like cemA are notoriously difficult to crystallize for X-ray crystallography, requiring specialized approaches such as lipidic cubic phase crystallization.

How can researchers address the challenges in developing stable transgenic lines of Cuscuta reflexa for long-term cemA functional studies?

To overcome the limitations in developing stable transgenic Cuscuta reflexa lines:

  • Germline transformation strategy: Target transformation to germinating seedlings rather than mature tissue, as the current protocol primarily achieves transient transformation in somatic cells .

  • Selective marker optimization: Develop selection systems specific to Cuscuta biology, considering its parasitic nature and potential innate resistance to common selective agents.

  • Tissue culture protocol development: Establish regeneration protocols for Cuscuta reflexa from transformed cells, potentially:

    • Testing various plant growth regulators

    • Exploring organogenesis from transformed haustorial cells

    • Developing embryogenic callus systems

  • Alternative transformation methods:

    • Explore biolistic transformation targeting meristematic regions

    • Test direct DNA uptake methods like polyethylene glycol-mediated transformation

    • Investigate virus-based gene delivery systems

  • Host-dependent propagation: Develop systems where transformed Cuscuta can be maintained on compatible hosts under selection, allowing for longer-term studies despite the absence of true transgenic lines.

  • Hairy root culture adaptation: Though initial efforts to induce hairy roots were unsuccessful , modified protocols with different A. rhizogenes strains and conditioning regimes might yield stable transformed tissue cultures.

What methodological approaches can overcome the contradictions in determining cemA function across different Cuscuta species?

To resolve contradictions in cemA functional characterization across Cuscuta species:

  • Standardized comparative analysis: Implement identical experimental protocols across multiple Cuscuta species at varying levels of parasitism (from facultative to obligate parasites).

  • Heterologous complementation testing: Express cemA from different Cuscuta species in model organisms with cemA knockouts to assess functional conservation and divergence.

  • Domain swapping experiments: Create chimeric cemA proteins with domains from different Cuscuta species to identify regions responsible for species-specific functions.

  • Integrated multi-omics approach: Combine:

    • Genomics: Sequence comparison across Cuscuta species

    • Transcriptomics: Expression analysis in equivalent developmental stages

    • Proteomics: Interactome mapping for cemA variants

    • Metabolomics: Downstream metabolic effects of cemA activity

  • Host range correlation studies: Systematically test if cemA sequence variations correlate with host range differences between Cuscuta species.

  • Machine learning prediction models: Develop algorithms to predict cemA function based on sequence features, trained on experimental data from diverse Cuscuta species.

How can understanding cemA function in Cuscuta reflexa contribute to developing control strategies for parasitic plants?

Knowledge of cemA function can inform parasitic plant control in several ways:

  • Target-based inhibitor development: If cemA proves essential for parasitism, designing small molecule inhibitors that specifically target this protein could provide selective control of Cuscuta without harming host plants.

  • Host resistance engineering: Understanding how cemA interacts with host proteins could allow for modification of these targets in crops, disrupting the parasite's ability to establish successful connections.

  • RNA interference strategies: Develop dsRNA constructs targeting cemA that could be expressed in host plants or applied externally, potentially disrupting cemA expression when the parasite attempts to establish contact.

  • Early detection systems: If cemA is involved in early stages of host recognition, antibodies or biosensors detecting cemA activity could be developed for early detection of Cuscuta infestation before visible attachment.

  • Biological control optimization: Knowledge of cemA function might reveal vulnerabilities in Cuscuta that could be exploited by biological control agents.

  • Ecological management strategies: Understanding the role of cemA in host selection could inform crop rotation or companion planting strategies to reduce Cuscuta infestation.

What implications does cemA research have for understanding the evolution of parasitism in plants?

Research on cemA offers valuable insights into plant parasitism evolution:

  • Plastid genome reduction patterns: The retention of cemA amid extensive gene loss in parasitic plants suggests functional constraints that reveal evolutionary pressures during the transition to parasitism .

  • Functional repurposing evidence: If cemA serves non-photosynthetic functions in Cuscuta, this would demonstrate how existing genes can be co-opted for new roles during evolutionary transitions.

  • Host-parasite co-evolution markers: Sequence variations in cemA across Cuscuta species may correlate with host preferences, revealing molecular signatures of co-evolutionary processes.

  • Convergent evolution assessment: Comparing cemA function between Cuscuta and distantly related parasitic plants could reveal if similar molecular mechanisms evolved independently.

  • Transitional state reconstruction: Studying cemA in Cuscuta species with different degrees of photosynthetic capacity helps reconstruct the stepwise process of evolving from autotrophy to heterotrophy.

  • Genetic basis of parasitism: Identifying specific mutations or regulatory changes in cemA that correlate with parasitic ability provides concrete examples of how complex traits like parasitism evolve at the molecular level.

How might insights from cemA research inform biotechnological applications beyond parasitic plant control?

Findings from cemA research could drive innovation in several biotechnology areas:

  • Novel transformation vectors: Understanding how Cuscuta transfers genetic material during parasitism could inspire new plant transformation technologies, particularly the highly efficient transformation observed in adhesive disks .

  • Engineered plant-plant communication: If cemA functions in inter-organism molecular communication, this knowledge could be harnessed to develop crops that communicate nutrient needs or defense responses.

  • Specialized protein delivery systems: The mechanisms by which parasitic plants introduce proteins into host tissues could inspire new methods for delivering therapeutic proteins into plant systems.

  • Metabolic engineering applications: Understanding how Cuscuta manipulates host metabolism through proteins like cemA could inform strategies for engineering plants with modified resource allocation.

  • Synthetic biology tools: The functional domains of cemA could be incorporated into synthetic proteins designed to perform novel functions in plastids or to target specific membrane systems.

  • Biosensor development: If cemA is involved in sensing host-derived signals, its binding domains could be repurposed for developing biosensors for agricultural or environmental monitoring.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.