Recombinant Cyanidioschyzon merolae ATP-dependent zinc metalloprotease FtsH (ftsH)

Shipped with Ice Packs
In Stock

Description

Structure and Function

FtsH complexes are typically composed of six protomers that form a hexagonal particle, with the soluble ATPase and protease domains interacting with neighboring protomers . These protomers can be identical (homohexamers) or different (heterohexamers), resulting in specialized functions . FtsH uses ATP-dependent proteolysis to degrade target substrates by unfolding and translocating them through the central pore of the ATPase complex to the protease domain .

Mechanism of Action

The current model suggests a flexible linker of approximately 20 amino acids between the transmembrane and ATPase domains, which allows substrates to access the protease . A phenylalanine residue on the top surface near the central pore of the ATPase domain is responsible for substrate binding . ATP hydrolysis induces conformational changes in the ATPase domain, causing the phenylalanine to slide into the central pore with the substrate . For each ATP-driven movement, the substrate can be translocated approximately 35 Å, with the unfolded peptide chain moving through internal channels to the protease catalytic site for degradation . Approximately 8 ATP molecules are consumed for each peptide cleavage reaction .

Role in Cyanidioschyzon merolae

Cyanidioschyzon merolae is a poly-extremophile red algae that thrives in high temperatures and low pH levels . C. merolae contains only one mitochondrion . FtsH in C. merolae is essential for mitochondrial protein targeting, where N-terminal peptides with specific amino acid compositions and a few basic residues are needed for protein targeting to the mitochondrion . A single arginine residue in an α-helix can give the functional property for the mitochondrial targeting peptide, and the position of the arginine residue is allowed in a broad range of the helical structure except for the flanking position .

FtsH in Chloroplasts

In chloroplasts, FtsH repairs photosystem II (PSII) damage caused by photoinhibition by cleaving the PSII reaction center protein D1 subunit .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ftsH; ATP-dependent zinc metalloprotease FtsH; FtsHCP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-603
Protein Length
full length protein
Species
Cyanidioschyzon merolae (strain 10D) (Red alga)
Target Names
ftsH
Target Protein Sequence
MKNLWIWSLPLIVLAFIGWQELANQMPVATSRMTYGRLLEYMQMGWVKRIDVYDRTALIE ASSPETGWQWIRVDLPANSSDWLEQAKTLHIDVDVHAVSNWINVASNWIIPLIIIGVVIW LLSRSASSNTTGALNFGKSKARFQMVAKTGIMFDDVAGIEEAKEELAEVVAFLKNPSKFL AVGASIPKGVLLVGPPGTGKTLLAKAIAGEASVPFFSISGSEFVEMFVGVGASRVRDLFK KAKQNAPCLVFIDEIDAVGRQRGAGIGGGNDEREQTLNQLLTEMDGFEGNTGVIVIAATN RVDVLDAALLRPGRFDRQIMVSMPDVKSRIAILKVHANQKKLHPQVSLEAVARRTAGFAG ADLANLLNEAAILAVRRGLKQITWKEIDDAIDRVIAGMEGTPIMDGKIKRLIAYHETGHA LTATLLPNHPPVQKVTLIPRRQAKGLTWFMQDNERDLLSKSQLMSMIMVALGGRAAEEAV FGNAEVTTGASNDLQQVTNLARQMVTRFGMSSLGPLCLETGNEEIFLGRDMRLMPEVSEE VIAQIDAQVRGMIEACYEKVLELMQANRVVMDRIVEELMEKETLDGKEFRQLVSQAARLT AVN
Uniprot No.

Target Background

Function
This protein functions as a processive, ATP-dependent zinc metallopeptidase.
Database Links
Protein Families
AAA ATPase family; Peptidase M41 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein; Stromal side.

Q&A

What is the basic structure and function of FtsH proteases in Cyanidioschyzon merolae?

FtsH proteases in C. merolae are members of the FtsH family of Zn²⁺ metalloproteases that perform diverse and essential functions in organelles. C. merolae possesses at least two distinct FtsH proteins: a chloroplast-encoded ftsH (ftsHcp) and a nuclear-encoded ftsH (ftsH2) . The chloroplast-encoded ftsHcp consists of 603 amino acids and shows highest similarity with algal-chloroplast and cyanobacterial FtsH proteins, while the nuclear-encoded ftsH2 encodes a protein of 920 amino acids with highest similarity to yeast mitochondrial FtsH proteins (Rca1p and Afg3p) .

Functionally, FtsH proteases in C. merolae, like their counterparts in other organisms, are involved in protein quality control, degradation of unfolded or damaged proteins, and likely play critical roles in organelle biogenesis. The recombinant FtsH1 exhibits zinc- and ATP-dependent protease activity that degrades loosely folded proteins such as α-casein .

How does the subcellular localization of FtsH proteins differ in C. merolae compared to other organisms?

In C. merolae, FtsH proteins show organelle-specific localization patterns that reflect their evolutionary origins. The ftsHcp is encoded within the chloroplast genome and localizes to chloroplast membranes, consistent with its cyanobacterial ancestry . The nuclear-encoded ftsH2 likely targets mitochondria, as evidenced by its amino-terminal extension containing an amphipathic α-helix characteristic of mitochondrial targeting signals .

This pattern differs from more complex organisms that typically have multiple nuclear-encoded FtsH genes targeting different organelles. The red algal chloroplast genome encodes the essential prokaryotic cell division gene ftsH, which has never been found in the mitochondrial genome of any organism . The preservation of organelle-specific FtsH proteins in C. merolae provides valuable insights into the evolutionary conservation of prokaryote-derived mechanisms for organelle division and maintenance.

What biochemical properties characterize the ATP dependence of C. merolae FtsH?

The ATP dependence of C. merolae FtsH is characterized by several key biochemical properties:

  • ATP binding can be detected through changes in the intrinsic tryptophan fluorescence of the protein. When ATP binds to the recombinant FtsH1, quenching of intrinsic fluorescence is observed, indicating conformational changes in the protein structure and/or masking of tryptophan residues .

  • ATP hydrolysis, not merely ATP binding, is required for substrate proteolysis. This has been demonstrated experimentally using AMPPNP (a non-hydrolyzable ATP analog). While casein degradation occurs in the presence of ATP, the protease is unable to degrade the substrate when only AMPPNP is available .

  • Although FtsH1 appears to be a weak ATPase (with activity levels too low to be detected by standard malachite green and EnzChek assays), ATP hydrolysis is essential for proper substrate presentation to the active site for degradation .

These properties suggest that while the proteolytic reaction itself is not energy-driven, ATP hydrolysis is likely required for correct presentation of protein substrates to the active site of the FtsH protease.

What experimental approaches can be used to characterize the zinc-dependent protease activity of recombinant C. merolae FtsH?

Several experimental approaches can be employed to characterize the zinc-dependent protease activity of recombinant C. merolae FtsH:

  • Proteolytic Assays with Model Substrates: Time-dependent proteolysis can be monitored using loosely folded proteins such as α-casein as a substrate. Casein degradation can be quantified over time in the presence of the recombinant FtsH1 protein under various conditions .

  • Metal Dependence Studies: The zinc dependence can be investigated by using metal chelators such as EDTA. Reduction in proteolytic activity upon addition of EDTA indicates the requirement for divalent cations (Zn²⁺) for enzymatic activity . Recovery of activity upon zinc supplementation can further confirm this dependence.

  • Nucleotide Dependence Analysis: The coupling between ATP hydrolysis and proteolytic activity can be studied using ATP analogs like AMPPNP. Comparative degradation assays in the presence of ATP versus AMPPNP can demonstrate whether ATP binding alone is sufficient or if ATP hydrolysis is required for proteolysis .

  • Tryptophan Fluorescence Spectroscopy: Intrinsic tryptophan fluorescence measurements can monitor conformational changes upon nucleotide binding. Quenching of fluorescence upon ATP binding indicates structural alterations that may be important for enzymatic function .

  • Site-Directed Mutagenesis: Targeted mutations in the zinc-binding site can provide insights into the role of specific residues in metal coordination and catalytic activity.

These approaches together provide a comprehensive characterization of the zinc-dependent protease activity of recombinant C. merolae FtsH.

How can researchers optimize recombinant expression and purification of C. merolae FtsH for structural and functional studies?

Optimizing recombinant expression and purification of C. merolae FtsH requires addressing several critical factors:

These optimizations can significantly improve the yield and quality of recombinant C. merolae FtsH for downstream structural and functional investigations.

What are the functional differences between chloroplast-encoded and nuclear-encoded FtsH proteins in C. merolae, and how can they be experimentally determined?

The functional differences between chloroplast-encoded (ftsHcp) and nuclear-encoded (ftsH2) FtsH proteins in C. merolae represent an important area of research in organellar biology:

Known Differences:

  • FtsHcp (603 amino acids) shows highest similarity with algal-chloroplast and cyanobacterial FtsH proteins

  • FtsH2 (920 amino acids) has highest similarity with yeast mitochondrial FtsHs (Rca1p and Afg3p)

  • FtsH2 contains an amino-terminal extension with characteristics of a mitochondrial targeting signal

Experimental Approaches to Determine Functional Differences:

  • Subcellular Localization Studies:

    • Fluorescent protein tagging to visualize the precise locations of each FtsH protein within C. merolae cells

    • Immunogold electron microscopy for high-resolution localization to specific organelle membranes

    • Subcellular fractionation followed by western blotting to biochemically confirm localization

  • Substrate Specificity Analysis:

    • Comparative proteolytic assays using different candidate substrates

    • Proteomics approaches to identify interacting partners and substrates for each FtsH protein

    • In vitro degradation assays with organelle-specific proteins to determine substrate preferences

  • Genetic Manipulation Approaches:

    • Targeted knockdown or knockout studies (where possible in C. merolae)

    • Complementation experiments in heterologous systems

    • Point mutations in critical domains to assess the impact on specific functions

  • Structural Comparisons:

    • Homology modeling based on known FtsH structures

    • Structural analyses using X-ray crystallography or cryo-EM if sufficient protein can be purified

    • Domain swapping experiments to identify functionally important regions

Through these approaches, researchers can delineate the specific roles of each FtsH protein in maintaining organelle integrity and function in C. merolae.

How do environmental stressors affect the expression and activity of FtsH proteases in C. merolae?

The extremophilic red alga C. merolae naturally grows in acidic hot springs (pH 0.5-3.0) at temperatures up to 56°C , suggesting that its cellular machinery, including FtsH proteases, has evolved to function under extreme conditions. Understanding the relationship between environmental stressors and FtsH expression/activity requires integrated experimental approaches:

  • Transcriptomic Analysis: RNA-seq studies under different stress conditions (temperature, pH, light intensity, CO₂ levels) can reveal how expression of ftsH genes is regulated. Previous transcriptomic studies in C. merolae have shown distinct changes in gene expression upon shifts between CO₂ conditions and in response to different light qualities .

  • Proteomics Approach: Quantitative proteomics can determine if protein levels of FtsH correlate with transcript levels or if post-transcriptional regulation occurs under stress conditions.

  • Activity Assays Under Stress Conditions: In vitro proteolytic assays using recombinant FtsH under varying pH, temperature, and salt concentrations can reveal how environmental factors directly impact enzymatic activity .

  • Correlation with Cellular Stress Responses: Analysis of FtsH activity in relation to other stress response pathways, such as heat shock proteins or oxidative stress response genes, can provide insights into integrated cellular adaptation mechanisms.

  • Organelle Integrity Assessment: Microscopy and biochemical approaches to monitor organelle structure and function under stress conditions can help correlate FtsH activity with maintenance of organellar homeostasis.

These studies would provide valuable insights into how this extremophilic alga adapts its protein quality control mechanisms to thrive in harsh environments.

What techniques are available for studying the interaction between FtsH proteases and their substrates in C. merolae?

Multiple complementary techniques can be employed to study the interactions between FtsH proteases and their substrates in C. merolae:

  • Co-immunoprecipitation (Co-IP): Using antibodies against tagged FtsH proteins to pull down interacting partners, followed by mass spectrometry identification. This approach can identify both substrates and regulatory proteins that associate with FtsH.

  • Proximity-based Labeling: BioID or APEX2 fused to FtsH can biotinylate proteins in close proximity, identifying the local proteome around FtsH in its native environment.

  • Crosslinking Mass Spectrometry: Chemical crosslinking followed by MS analysis can capture transient interactions between FtsH and substrates during the degradation process.

  • In vitro Degradation Assays: Purified recombinant FtsH can be incubated with candidate substrates to monitor degradation rates and patterns. This approach has been demonstrated using α-casein as a model substrate .

  • Fluorescence Resonance Energy Transfer (FRET): Fluorescently labeled FtsH and substrate proteins can be used to monitor interactions in real-time and in living cells.

  • Surface Plasmon Resonance (SPR): This technique can determine binding kinetics and affinities between purified FtsH and potential substrates or regulators.

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): This can identify regions of FtsH that undergo conformational changes upon substrate binding or during the catalytic cycle.

These techniques, used in combination, can provide comprehensive insights into how FtsH proteases recognize, bind, and process their substrates in C. merolae.

How can researchers differentiate between the roles of FtsH in protein quality control versus developmental regulation in C. merolae?

Differentiating between protein quality control and developmental regulatory functions of FtsH proteases requires experimental designs that can separate these distinct roles:

  • Temporal Expression Analysis:

    • Monitor FtsH expression and activity across different developmental stages of C. merolae

    • Time-course experiments during cell division, as FtsH has been implicated in cytokinesis

    • Correlation of expression patterns with developmental transitions versus stress responses

  • Substrate Identification and Classification:

    • Proteomics approaches to identify FtsH substrates under normal versus stress conditions

    • Categorization of substrates as damaged/misfolded proteins (quality control) versus functional proteins (developmental regulation)

    • Analysis of degradation kinetics for different substrate classes

  • Conditional Mutations or Inducible Systems:

    • Generation of temperature-sensitive or inducible FtsH variants

    • Assessment of phenotypic consequences when FtsH function is disrupted during specific developmental windows versus under stress conditions

  • Domain-specific Mutations:

    • Engineering mutations that specifically affect substrate recognition versus catalytic activity

    • Analysis of how these mutations differentially impact quality control versus developmental functions

  • Comparative Analysis Across Conditions:

    • Side-by-side comparison of FtsH activity during oxidative stress (quality control function) versus cell division (developmental function)

    • Identification of condition-specific cofactors or regulators that may direct FtsH toward different substrate pools

  • Microscopy Combined with Biochemical Approaches:

    • Visualization of FtsH localization during normal growth versus stress conditions

    • Correlation of spatial distribution with different functional states

These approaches can help delineate the dual roles of FtsH in maintaining protein homeostasis and regulating developmental processes in C. merolae.

What comparative genomic approaches can reveal the evolution of FtsH proteases in red algae and related organisms?

Comparative genomic approaches provide powerful tools for understanding the evolutionary history of FtsH proteases in red algae and related organisms:

  • Phylogenetic Analysis:

    • Construction of comprehensive phylogenetic trees using FtsH sequences from diverse organisms

    • Analysis of evolutionary relationships between chloroplast-encoded and nuclear-encoded FtsH proteins

    • Determination of orthologous relationships between C. merolae FtsH proteins and those in other species

  • Synteny Analysis:

    • Examination of gene order and genomic context of FtsH genes across related species

    • Identification of conserved gene clusters that may indicate functional relationships

  • Domain Architecture Comparison:

    • Analysis of domain organization in FtsH proteins across different lineages

    • Identification of lineage-specific domain acquisitions or losses

  • Selection Pressure Analysis:

    • Calculation of dN/dS ratios to identify sites under positive or purifying selection

    • Detection of accelerated evolution in specific lineages or domains

  • Gene Duplication and Loss Patterns:

    • Reconstruction of gene duplication and loss events throughout the evolutionary history of FtsH genes

    • Correlation of these events with major evolutionary transitions

  • Endosymbiotic Gene Transfer Analysis:

    • Investigation of the evolutionary history of organellar FtsH genes and their transfer to the nucleus

    • Comparison of chloroplast-encoded ftsHcp in C. merolae with nuclear-encoded homologs in other algae and plants

  • Correlation with Organismal Adaptations:

    • Analysis of how FtsH evolution correlates with adaptation to specific environmental niches

    • Comparison between extremophiles like C. merolae and mesophilic relatives

These comparative approaches can provide insights into how FtsH proteases have evolved and diversified across different lineages, potentially revealing how these essential proteases have been adapted for specific cellular functions in different organisms.

What are the key challenges in expressing and purifying active recombinant C. merolae FtsH, and how can they be overcome?

Expressing and purifying active recombinant C. merolae FtsH presents several challenges, each requiring specific strategies to overcome:

ChallengeDescriptionSolution Strategies
Membrane protein solubilityFtsH is a membrane-bound protease with transmembrane domainsExpress soluble domains (ATPase and protease, ~57 kDa) without transmembrane regions ; Use detergents for full-length expression; Consider fusion tags that enhance solubility
Maintaining zinc coordinationActivity depends on proper zinc coordinationAvoid metal chelators like EDTA during purification ; Include appropriate concentrations of Zn²⁺ in purification buffers
Preserving ATPase activityATP hydrolysis is required for proteolytic functionInclude ATP or non-hydrolyzable analogs during purification; Minimize exposure to conditions that might cause denaturation
Proteolytic self-degradationActive protease may degrade itselfUse protease inhibitors selectively; Consider expression of catalytically inactive mutants for structural studies
Expression toxicityOverexpression may be toxic to host cellsUse tightly controlled inducible expression systems; Consider cell-free expression systems
Protein instabilityMaintaining stable, active conformationOptimize buffer conditions (pH, salt, glycerol); Express at lower temperatures; Consider stability-enhancing mutations
Low expression levelsHeterologous expression may yield insufficient proteinCodon optimization for expression host; Explore alternative expression systems (yeast, insect cells); Scale up cultivation

By systematically addressing these challenges, researchers can improve the yield and quality of recombinant C. merolae FtsH for subsequent structural and functional studies. The successful expression strategy reported for the 57 kDa recombinant ATPase and protease domain provides a good starting point for further optimization.

How can researchers accurately assess the role of FtsH in organellar division and biogenesis in C. merolae?

Accurately assessing the role of FtsH in organellar division and biogenesis in C. merolae requires an integrated experimental approach:

  • High-Resolution Imaging Techniques:

    • Fluorescence microscopy with FtsH-specific antibodies or fluorescent protein fusions to visualize localization during organelle division

    • Live-cell imaging to track FtsH dynamics during the division process

    • Super-resolution microscopy to precisely localize FtsH relative to the division machinery

    • Electron microscopy to examine ultrastructural changes in FtsH-depleted cells

  • Genetic Manipulation Strategies:

    • Conditional knockdown or knockout of FtsH genes if feasible in C. merolae

    • Expression of dominant-negative FtsH mutants

    • Complementation studies with wild-type and mutant variants

  • Biochemical Interaction Studies:

    • Identification of protein complexes containing FtsH during different stages of organelle division

    • Analysis of post-translational modifications that might regulate FtsH activity during division

    • Characterization of physical interactions between FtsH and known division proteins

  • Functional Assays:

    • Quantitative assessment of organelle division rates in cells with altered FtsH function

    • Analysis of organelle morphology and integrity

    • Measurement of organelle function (e.g., photosynthetic efficiency for chloroplasts, respiratory capacity for mitochondria)

  • Comparative Analysis:

    • Parallel studies of chloroplast-encoded ftsHcp and nuclear-encoded ftsH2 to assess their potentially distinct roles in chloroplast and mitochondrial division, respectively

    • Comparison with model organisms where FtsH function is better characterized

  • Systems Biology Approach:

    • Integration of transcriptomic, proteomic, and metabolomic data to build comprehensive models of FtsH function

    • Network analysis to identify regulatory connections between FtsH and other division components

These approaches, used in combination, can provide a comprehensive understanding of how FtsH proteases contribute to organellar division and biogenesis in C. merolae.

What approaches can be used to study the structural dynamics of C. merolae FtsH during substrate processing?

Understanding the structural dynamics of C. merolae FtsH during substrate processing requires sophisticated biophysical approaches:

By combining these complementary approaches, researchers can build a dynamic picture of how C. merolae FtsH undergoes structural changes during substrate recognition, unfolding, and degradation.

How might C. merolae FtsH proteases be utilized as model systems for understanding extremophilic protein adaptation and function?

C. merolae thrives in acidic hot springs with temperatures up to 56°C and pH as low as 0.5-3.0 , making its proteins excellent models for studying extremophilic adaptations:

  • Comparative Structural Analysis:

    • Detailed structural comparison between C. merolae FtsH and mesophilic homologs

    • Identification of unique structural features that confer thermostability and acid tolerance

    • Analysis of amino acid composition patterns associated with extremophilic adaptation

  • Structure-Function Relationship Studies:

    • Engineering chimeric proteins combining domains from extremophilic and mesophilic FtsH proteins

    • Systematic mutagenesis to identify specific residues contributing to extremophilic properties

    • Correlation of structural features with biochemical activities under extreme conditions

  • In vitro Evolution and Directed Evolution:

    • Using C. merolae FtsH as a starting point for directed evolution experiments targeting enhanced stability

    • Selection for variants with improved function under even more extreme conditions

    • Identification of evolutionary trajectories leading to extremophilic adaptation

  • Application in Biomaterials and Biotechnology:

    • Exploration of potential applications leveraging the extreme stability of C. merolae FtsH

    • Development of robust enzymatic systems for industrial processes requiring harsh conditions

    • Identification of stabilizing motifs that could be transferred to other proteins

  • Environmental Adaptation Studies:

    • Investigation of how C. merolae FtsH function responds to fluctuations in environmental conditions

    • Understanding the molecular mechanisms underlying rapid adaptation to changing extremes

    • Correlation with transcriptional responses to environmental changes

  • Protein Folding and Stability Research:

    • Analysis of folding pathways and kinetics under extreme conditions

    • Investigation of how extremophilic proteins maintain proper folding despite destabilizing environments

    • Identification of stabilizing interactions unique to extremophilic proteins

The study of C. merolae FtsH as a model extremophilic protein could provide valuable insights for protein engineering and biotechnological applications requiring enzymes that function under extreme conditions.

What insights can C. merolae FtsH provide for understanding the evolution of organellar protein quality control systems?

C. merolae represents a unique model for studying the evolution of organellar protein quality control systems due to its primitive position in the red algal lineage and its retention of both nuclear-encoded and chloroplast-encoded FtsH genes:

  • Evolutionary Origin Analysis:

    • Comparative genomic studies between the chloroplast-encoded ftsHcp and nuclear-encoded ftsH2 to understand their evolutionary relationships

    • Investigation of the selective pressures that maintained ftsH in the chloroplast genome while most organellar genes transferred to the nucleus

    • Analysis of how FtsH function adapted during the transition from endosymbiont to organelle

  • Functional Divergence Studies:

    • Examination of how FtsH functions specialized between different organelles

    • Comparison of substrate specificity between mitochondrial and chloroplast FtsH proteins

    • Investigation of how regulatory mechanisms evolved to control FtsH activity in different cellular compartments

  • Comparative Analyses Across Eukaryotic Lineages:

    • Systematic comparison of C. merolae FtsH with homologs from plants, fungi, and other protists

    • Identification of lineage-specific adaptations in protein quality control systems

    • Reconstruction of the evolutionary history of FtsH-based quality control across eukaryotes

  • Analysis of Protein Targeting Evolution:

    • Study of how targeting signals evolved to direct nuclear-encoded FtsH proteins to specific organelles

    • Investigation of the amino-terminal extension of FtsH2 that appears to function as a mitochondrial targeting signal

    • Comparison with targeting mechanisms in more complex eukaryotes

  • Co-evolution with Substrate Proteins:

    • Examination of how FtsH proteins co-evolved with their substrate proteins

    • Analysis of recognition motifs in substrate proteins across different lineages

    • Investigation of how substrate specificity changed during eukaryotic evolution

  • Integration with Other Quality Control Systems:

    • Study of how FtsH-based quality control integrates with other systems (e.g., chaperones, other proteases)

    • Analysis of the minimal quality control machinery in C. merolae compared to more complex eukaryotes

    • Investigation of how layered quality control systems evolved

These studies could provide fundamental insights into how organellar protein quality control systems evolved from prokaryotic ancestors and diversified during eukaryotic evolution.

How can the unique properties of C. merolae FtsH inform the design of engineered proteases for biotechnology applications?

The unique properties of C. merolae FtsH, particularly its adaptation to extreme conditions, offer valuable insights for protein engineering and biotechnology applications:

  • Thermostability Engineering:

    • Identification of structural features contributing to the thermostability of C. merolae FtsH

    • Transfer of thermostabilizing motifs to less stable proteases

    • Rational design of engineered proteases with enhanced temperature resistance for industrial applications

  • pH Tolerance Optimization:

    • Analysis of acid-tolerant characteristics of C. merolae proteins

    • Engineering of proteases that maintain activity across broader pH ranges

    • Development of variants suitable for acidic industrial processes

  • Substrate Specificity Modification:

    • Analysis of the substrate recognition mechanisms in C. merolae FtsH

    • Engineering of the substrate-binding pocket to alter specificity

    • Development of proteases with novel or expanded substrate ranges for specific biotechnological applications

  • Energy Efficiency Improvement:

    • Study of the ATP-dependence characteristics of C. merolae FtsH

    • Engineering of variants with altered energetic requirements

    • Development of proteases with optimized energy consumption

  • Protease Regulation Systems:

    • Analysis of how C. merolae controls FtsH activity in different cellular compartments

    • Design of synthetic regulatory systems for engineered proteases

    • Development of conditionally active proteases for specific applications

  • Membrane Association Optimization:

    • Study of how C. merolae FtsH associates with organellar membranes

    • Engineering of proteases with tailored membrane interaction properties

    • Development of variants suitable for specific membrane environments or soluble applications

  • Stability-Activity Balance:

    • Investigation of how C. merolae FtsH maintains catalytic activity despite stabilizing adaptations

    • Engineering of variants that optimize the trade-off between stability and activity

    • Development of proteases that combine high stability with efficient catalytic function

By leveraging the unique adaptations of C. merolae FtsH to extreme conditions, researchers can develop novel engineered proteases with enhanced properties for various biotechnological applications, including biocatalysis under harsh conditions, protein processing in industrial settings, and therapeutic enzyme development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.