Recombinant Cyanidioschyzon merolae ATP synthase subunit b, chloroplastic (atpF)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Cyanidioschyzon merolae ATP Synthase Subunit b, Chloroplastic (atpF)

Recombinant Cyanidioschyzon merolae ATP synthase subunit b, chloroplastic (atpF), is a protein component of the ATP synthase complex found in the chloroplasts of the unicellular red alga Cyanidioschyzon merolae. This enzyme plays a crucial role in the process of photosynthesis by generating ATP from ADP and inorganic phosphate using the energy derived from sunlight. The recombinant form of this protein is produced through genetic engineering techniques, allowing for its study and application in various biochemical and biotechnological contexts.

Structure and Function

The ATP synthase complex in chloroplasts is responsible for the light-dependent synthesis of ATP, a critical energy currency in cells. The subunit b of this complex, encoded by the atpF gene, is essential for the assembly and function of the ATP synthase. It is involved in the proton translocation process across the thylakoid membrane, which drives the synthesis of ATP.

Protein DetailsDescription
Protein NameATP synthase subunit b', chloroplastic
OrganismCyanidioschyzon merolae (strain NIES-3377 / 10D)
Amino Acids143
GeneatpF2 (also known as atpG)
FunctionEssential for ATP synthesis in chloroplasts

Research Findings

Research on Cyanidioschyzon merolae has highlighted its unique characteristics as a model organism for studying organelle division and photosynthesis. The simplicity of its genome and cellular structure makes it an attractive system for investigating the basic mechanisms of chloroplast function, including ATP synthesis.

  • Genomic Context: The complete genome sequence of C. merolae has provided insights into the genetic basis of its photosynthetic apparatus. The atpF gene, encoding the subunit b of ATP synthase, is part of this genomic framework, contributing to the organism's ability to thrive in extreme environments .

  • Photosynthetic Efficiency: Studies have shown that light intensity and quality significantly affect the photosynthetic apparatus of C. merolae, including the efficiency of ATP synthesis .

Recombinant Production and Applications

Recombinant production of the ATP synthase subunit b allows for detailed biochemical analysis and potential biotechnological applications. This could include improving photosynthetic efficiency in other organisms or developing novel bioenergy systems.

Application AreasPotential Uses
BioenergyEnhancing photosynthetic efficiency in crops or bioengineered organisms
BiotechnologyDevelopment of novel ATP-producing systems for industrial applications
Basic ResearchUnderstanding the mechanisms of ATP synthesis in chloroplasts

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If a specific tag type is required, please inform us; we will prioritize its use in production.
Synonyms
atpF; ATP synthase subunit b, chloroplastic; ATP synthase F(0 sector subunit b; ATPase subunit I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Cyanidioschyzon merolae (strain 10D) (Red alga)
Target Names
atpF
Target Protein Sequence
MHTLLETLLESNVINIAILVVILIRFARQVVGEILVQRQQQVKEALEEASNRLKLAEQQL KTAQEEWSQTQEQINQIEEEANQTAQVVKEYWLKQANEAIAQLKTKTQQSLSQASRQVAK QIRQTLIELAIEKVKQTPIDGSQILDRHISLLSYHEAKNR
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase catalyzes ATP synthesis from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F(1) catalytic core (extramembranous) and the F(0) membrane proton channel. These are connected by a central and a peripheral stalk. ATP synthesis in the F(1) catalytic domain is coupled, via a rotary mechanism involving the central stalk subunits, to proton translocation. This protein is a component of the F(0) channel, forming part of the peripheral stalk and linking F(1) to F(0).
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Cyanidioschyzon merolae and why is it significant for ATP synthase research?

Cyanidioschyzon merolae is a species of eukaryotic extremophilic red algae that thrives in highly acidic environments (pH 0.2-4) and elevated temperatures (40-56°C). It possesses an exceptionally simple cellular architecture, featuring a single chloroplast, mitochondrion, and nucleus, making it an ideal model organism for studying organellar proteins like ATP synthase . Its complete genomic sequence (nuclear, plastid, and mitochondrial) provides a solid foundation for recombinant protein studies, while its extremophilic nature makes its ATP synthase particularly interesting for understanding protein adaptation to harsh conditions .

What are the structural characteristics of ATP synthase subunit b (atpF) in C. merolae?

ATP synthase subunit b (atpF) in C. merolae is a chloroplastic protein component of the F₀ portion of the ATP synthase complex. Unlike its bacterial counterparts, the chloroplastic atpF in C. merolae has adapted to function in the unique environment of the thylakoid membrane under acidic and high-temperature conditions. The protein contains conserved regions necessary for interaction with other ATP synthase subunits and plays a crucial role in connecting the F₁ and F₀ portions of the complex, thereby facilitating the energy transfer necessary for ATP synthesis during photosynthesis .

What is the recommended protocol for recombinant expression of C. merolae atpF?

For recombinant expression of C. merolae atpF, the following optimized protocol is recommended based on successful approaches used with other C. merolae proteins:

  • Construct preparation: Clone the atpF gene from C. merolae genomic DNA into an expression vector containing an arabinose-inducible promoter (such as pBAD).

  • Transformation: Transform the vector into an E. coli expression strain (BL21 or similar).

  • Culture conditions: Grow transformed E. coli in LB medium with appropriate antibiotic selection at 37°C until OD₆₆₀ reaches 0.4.

  • Induction: Induce protein expression with arabinose (1 mg/mL final concentration) for one hour.

  • Harvest: Cool cells on ice for 30 minutes, then centrifuge at 8,000 rpm for 10 minutes.

  • Cell lysis: Resuspend pellets in 50 mM NaPO₄ buffer (pH 7.0), then lyse cells via sonication (0.25/0.75 seconds on/off for 15 minutes).

  • Solubilization: Add 1% SDS and incubate overnight to solubilize inclusion bodies if necessary .

This protocol may require modification based on the specific properties of atpF, with particular attention to pH and salt concentration to maintain protein stability.

What purification strategies are most effective for C. merolae recombinant proteins?

Based on experience with other C. merolae proteins, a multi-step purification strategy is recommended for recombinant atpF:

  • Initial purification: Affinity chromatography using a tag system (His-tag or similar).

  • Intermediate purification: Ion-exchange chromatography, with conditions adjusted for the protein's theoretical pI.

  • Final purification: Size-exclusion chromatography to achieve high purity.

Particular challenges may arise with chloroplastic proteins like atpF. For example, the plastid-encoded protein CmP from C. merolae required high pH (10.0) and high salt concentration (300 mM NaCl) to avoid aggregation during purification . Similarly, stability testing at various pH values and salt concentrations is crucial for atpF purification. Consider screening with a range of pH values (7.0-10.0) and NaCl concentrations (100-300 mM) to determine optimal conditions .

How should researchers assess the functional activity of recombinant C. merolae atpF?

Functional assessment of recombinant atpF should include:

  • ATP synthase complex assembly: Co-immunoprecipitation or blue native PAGE to verify interaction with other subunits.

  • Proton conductance: Reconstitution in liposomes followed by pH-dependent fluorescence quenching assays.

  • Structural integrity: Circular dichroism spectroscopy to confirm proper secondary structure, particularly alpha-helical content.

  • Thermal stability: Differential scanning calorimetry to determine if the recombinant protein retains the thermostability characteristic of the native extremophilic enzyme.

  • Light-dependent activity: Assessing ATP synthesis rates under varying light qualities and intensities, similar to the whole-cell studies showing modulation of ATP/ADP ratios under different light conditions .

How does C. merolae ATP synthase adapt to extreme acidic conditions, and what insights does this provide for protein engineering?

C. merolae ATP synthase represents a valuable model for acid-stable protein engineering due to its adaptation to function at pH values as low as 0.2. Research suggests that the adaptations likely include:

  • Surface charge distribution: Increased proportion of acidic residues on the protein surface.

  • Proton handling: Specialized amino acid substitutions in the proton channel components.

  • Structural stabilization: Additional salt bridges and hydrophobic interactions.

When working with recombinant atpF, researchers should consider these adaptations when designing mutations for structure-function studies. Comparative analysis between C. merolae atpF and homologs from neutrophilic organisms can reveal specific residues responsible for acid stability. These insights have broader applications for designing acid-stable enzymes for industrial biotechnology and understanding fundamental principles of protein adaptation to extreme environments .

How does light quality and intensity affect the expression and assembly of ATP synthase in C. merolae?

Research on C. merolae has demonstrated that both light quality and intensity significantly influence cellular energetics and protein expression patterns. The ATP/ADP ratio varies markedly under different light conditions, suggesting regulatory effects on ATP synthase activity . For researchers studying atpF, several considerations emerge:

  • Spectral sensitivity: The highest ATP/ADP ratios occur under yellow-LL and red-LL conditions (6.3 and 10.9, respectively), suggesting optimal ATP synthase activity under these specific light qualities .

  • Light intensity effects: High light intensity consistently reduces ATP content across all spectral conditions, indicating potential down-regulation of ATP synthase activity or increased ATP consumption under high light stress .

  • Experimental design implications: These findings suggest that researchers should carefully control light conditions when studying recombinant atpF or when comparing data across experimental setups.

The table below summarizes the relative ATP/ADP ratios under various light conditions, which may guide experimental design when studying ATP synthase components:

Light ConditionATP/ADP RatioRelative ATP Content
White-LL~3.5 (baseline)Baseline
White-HL~3.0-15%
Blue-LL~3.0-15%
Blue-HL~1.5-50%
Yellow-LL~6.3+100%
Yellow-HL~2.5-30%
Red-LL~10.9+100%
Red-HL~2.3-35%

These values are approximated from the research data and highlight the importance of light conditions in ATP synthase research .

What methodological approaches should be used to study the interaction between atpF and other ATP synthase subunits in C. merolae?

To investigate the interactions between atpF and other ATP synthase subunits in C. merolae, researchers should employ multiple complementary techniques:

  • Yeast two-hybrid or bacterial two-hybrid systems: Modified to accommodate the potentially unique interaction requirements of extremophilic proteins.

  • Co-immunoprecipitation followed by mass spectrometry: This approach can identify not only direct binding partners but also larger complexes.

  • Förster resonance energy transfer (FRET): Using fluorescently tagged subunits to detect in vivo interactions and their dynamics under different environmental conditions.

  • Cross-linking coupled with mass spectrometry: To identify specific interaction interfaces between atpF and other subunits.

  • Single-particle cryo-electron microscopy: For structural characterization of the assembled ATP synthase complex, providing insights into the architectural role of atpF.

  • Molecular dynamics simulations: To predict interaction energies and conformational changes under different pH and temperature conditions relevant to C. merolae's natural environment .

The heterooligomeric nature of protein complexes in C. merolae, as demonstrated with the rubisco activase (Rca) system , suggests that ATP synthase assembly may similarly involve sophisticated coordination between nuclear and plastid-encoded components. This consideration should guide experimental design when studying atpF interactions.

What are the main obstacles in expressing active C. merolae ATP synthase components in heterologous systems?

Researchers frequently encounter several challenges when expressing C. merolae ATP synthase components like atpF:

  • Protein solubility: The hydrophobic nature of membrane proteins like atpF often leads to aggregation or inclusion body formation in E. coli. Solution: Optimize expression conditions by testing lower induction temperatures (16-25°C), using specialized E. coli strains designed for membrane proteins, or incorporating solubility tags.

  • Proper folding: The extremophilic origin of C. merolae proteins can result in folding challenges in mesophilic expression systems. Solution: Co-express with chaperones or consider cell-free protein synthesis systems that can be adjusted to match C. merolae's native pH and temperature.

  • Post-translational modifications: Any native modifications may be absent in bacterial systems. Solution: Consider eukaryotic expression systems if modifications are suspected to be crucial for function.

  • Expression toxicity: Membrane proteins can disrupt host cell membranes. Solution: Use tightly controlled inducible promoters and optimize induction timing and strength .

The successful expression of other C. merolae proteins, such as DNA polymerases PolA and PolB , demonstrates that these challenges can be overcome with appropriate optimization strategies.

How can researchers overcome protein stability issues when working with recombinant C. merolae atpF?

Maintaining the stability of recombinant C. merolae atpF requires strategies that account for its extremophilic origin:

  • Buffer optimization: Screen a range of pH values (4.0-10.0) and salt concentrations (100-500 mM), as the plastid-encoded protein CmP from C. merolae required pH 10.0 and 300 mM NaCl to avoid aggregation .

  • Additive screening: Include stabilizing agents such as glycerol (5-20%), sucrose, or specific detergents for membrane proteins (DDM, LDAO, or C12E8).

  • Temperature considerations: Despite C. merolae's thermophilic nature, recombinant proteins may benefit from storage at 4°C rather than room temperature to reduce degradation.

  • Reductant addition: Include reducing agents like DTT or β-mercaptoethanol if the protein contains cysteine residues that might form inappropriate disulfide bonds.

  • Protease inhibitors: Always include a protease inhibitor cocktail to prevent degradation, especially when working with cell extracts.

The differential stability properties observed between nuclear and plastid-encoded proteins in C. merolae suggest that understanding the evolutionary origin of atpF may provide clues to its optimal handling conditions .

How might structural modifications of C. merolae atpF enhance our understanding of ATP synthase adaptation to extreme environments?

Future research on C. merolae atpF could focus on structure-function relationships through targeted modifications:

  • Chimeric constructs: Creating fusion proteins between C. merolae atpF and homologs from neutrophilic organisms to identify regions responsible for acid stability.

  • Point mutation analysis: Systematic substitution of conserved residues to identify those critical for function in acidic environments.

  • Domain swapping: Exchanging specific domains with those from mesophilic homologs to understand regional contributions to extremophilic adaptation.

  • Cysteine scanning mutagenesis: Introducing cysteines at strategic positions for cross-linking studies to map structural changes under varying pH and temperature conditions.

  • Deletion analysis: Creating truncated versions to identify minimal functional domains required for ATP synthase assembly and function.

These approaches could reveal fundamental principles of protein adaptation to extreme environments and potentially inform the design of synthetic enzymes for industrial applications requiring acid stability .

What insights might C. merolae ATP synthase provide for understanding the evolution of energy metabolism in extremophiles?

The study of C. merolae ATP synthase components offers unique perspectives on the evolution of bioenergetic systems:

  • Comparative genomics: Analysis of atpF sequences across the red algal lineage could reveal evolutionary trajectories of adaptation to extreme environments.

  • Ancestral sequence reconstruction: Computational resurrection of ancestral atpF sequences may provide insights into the stepwise adaptation to acidic conditions.

  • Horizontal gene transfer assessment: Investigation of whether extremophilic adaptations in ATP synthase components originated through horizontal gene transfer from archaeal extremophiles.

  • Coevolution analysis: Examination of coordinated evolutionary changes between atpF and other ATP synthase subunits to maintain functional compatibility.

The presence of both nuclear and plastid-encoded components in C. merolae organellar complexes, as seen with the rubisco activase system , suggests a complex evolutionary history potentially relevant to ATP synthase as well. This evolutionary perspective could enhance our understanding of how fundamental bioenergetic machinery adapts to extreme conditions .

How can systems biology approaches integrate data on C. merolae ATP synthase with broader metabolic networks?

Systems biology offers powerful frameworks for understanding how ATP synthase components like atpF function within the broader context of C. merolae metabolism:

  • Multi-omics integration: Combining transcriptomics, proteomics, and metabolomics data to map how ATP synthase expression responds to environmental changes.

  • Flux balance analysis: Creating computational models of C. merolae energy metabolism to predict how alterations in ATP synthase activity affect cellular energetics.

  • Protein-protein interaction networks: Mapping the interaction landscape of atpF beyond the ATP synthase complex to identify potential regulatory connections.

  • Temporal dynamics modeling: Investigating how ATP synthase assembly and activity change throughout the cell cycle, particularly given that some C. merolae proteins show cell cycle-dependent expression .

  • Environmental response modeling: Using the data on ATP/ADP ratios under different light conditions to develop predictive models of how ATP synthase activity responds to environmental fluctuations.

These integrative approaches could reveal how ATP synthase functions as part of a coordinated system rather than in isolation, potentially identifying novel regulatory mechanisms and metabolic interdependencies specific to extremophilic adaptation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.