Recombinant Cyanidioschyzon merolae Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cemA; ycf10; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-276
Protein Length
full length protein
Species
Cyanidioschyzon merolae (strain 10D) (Red alga)
Target Names
cemA
Target Protein Sequence
MKNWPLTTRSAFEKTGPIPRSISKTFEKLWKELDASAENEVMEEWRVARYQTVASLKYLL LLILIPVLVNQMSKSWIFGPLVDHVWSVNHADIFLNASQEERAFAQLQRFEERLHFDMLI GRLPTLSEEVIQQQIKNKALEIAYQYAQESAYAVKNVLADSASVASFLALMRFGKRQLSV FQSFVNEFIYGLSDTAKAFFIILFTDMFIGFHSPHGWEVLMEAVLRHFGLPENRDFIFLF IATFPVALDTVFKYWIFRYLNRVSPSAVATYHNMNE
Uniprot No.

Target Background

Function
This protein may be involved in proton extrusion and indirectly promotes efficient inorganic carbon uptake into chloroplasts.
Database Links
Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

What is Cyanidioschyzon merolae and why is it significant for research?

Cyanidioschyzon merolae is a polyextremophilic red alga that thrives in acidic hot springs. This unicellular organism exhibits optimal growth at temperatures between 42-50°C and pH levels of 0.5-2.5 . Its significance stems from several unique characteristics:

  • Simple cellular structure with only one nucleus, one mitochondrion, and one chloroplast

  • Complete genome sequencing (16.5 Mb nuclear genome)

  • Ability to photosynthesize efficiently in extreme environments

  • Valuable metabolites including thermostable phycocyanin, starch, β-glucan, and carotenoid pigments

C. merolae serves as an excellent model organism for studying fundamental cellular processes under extreme conditions and has applications in understanding evolutionary adaptations to harsh environments.

How does cemA contribute to C. merolae's adaptation to extreme environments?

C. merolae thrives in acidic hot springs where photosynthesis is challenging due to:

  • High temperatures that reduce CO2 solubility

  • Acidic conditions that affect protein stability

  • Low availability and slow diffusion of carbon dioxide

Research indicates that cemA plays a role in the carbon-concentrating mechanism that allows C. merolae to overcome these challenges. Studies have shown that C. merolae exhibits characteristics typical of organisms possessing CCMs:

CCM CharacteristicC. merolae MeasurementSignificance
CO2 compensation pointLowIndicates efficient carbon fixation
Affinity for external CO2HighEnables carbon capture in low-CO2 environments
Rubisco oxygenationMinimizedReduces photorespiration
Biomass δ13CConsistent with CCMConfirms active carbon concentration

Unlike many other photosynthetic organisms with CCMs, C. merolae lacks a pyrenoid structure and primarily takes up carbon dioxide rather than bicarbonate, suggesting a unique and possibly pH-gradient-based CCM mechanism in which cemA may be instrumental .

What are the optimal conditions for expressing recombinant cemA from C. merolae?

Successful expression of recombinant cemA requires careful optimization of multiple variables. While specific protocols for cemA expression are still emerging, general principles for recombinant protein expression from extremophiles can be applied:

The following multivariate design parameters have proven effective for other recombinant proteins and can be adapted for cemA expression:

VariableRecommended Range for TestingOptimization Strategy
Temperature16-37°CTest 3-4 points across range
IPTG concentration0.1-1.0 mMFactorial design
Media compositionLB, TB, minimal mediaComparative analysis
Induction timeEarly to late log phaseTime-course experiments
Post-induction period4-24 hoursTime-course analysis

How can researchers verify the functionality of recombinant cemA protein?

Verification of recombinant cemA functionality requires multiple approaches to assess both structural integrity and functional activity:

  • Structural Verification:

    • SDS-PAGE to confirm correct molecular weight (expected ~31 kDa)

    • Western blotting with specific antibodies

    • Mass spectrometry for peptide fingerprinting

    • Circular dichroism spectroscopy to assess secondary structure

  • Functional Assays:

    • Carbon uptake measurements using an open-path infrared gas analyzer

    • Comparison of CO2 affinity parameters between wild-type and recombinant protein systems

    • Measurement of photosynthetic efficiency under various CO2 concentrations

  • Interaction Studies:

    • Co-immunoprecipitation to identify protein partners

    • Reconstitution into liposomes to assess membrane integration

    • Localization studies using fluorescent tags or immunogold labeling

When designing functionality assays, it's important to consider the extreme conditions in which native cemA operates. Assays should ideally be conducted across a range of pH (0.5-7.0) and temperature (25-50°C) conditions to fully characterize the protein's functionality envelope.

How does the structure of cemA relate to its function in carbon concentration mechanisms?

The structure-function relationship of cemA remains an active area of research. Current evidence suggests several key structural features that contribute to its function:

  • Transmembrane Domains: Hydropathy analysis of the cemA sequence reveals multiple putative transmembrane regions that likely anchor the protein within the chloroplast envelope membrane .

  • Protein Topology: The precise orientation of cemA within the membrane has implications for understanding its role in carbon transport. Current models suggest:

    • N-terminal region likely faces the stromal side

    • C-terminal domain may be exposed to the intermembrane space

    • Multiple membrane-spanning regions create channels or pores for CO2/HCO3- transport

  • Functional Domains: Sequence analysis and comparative studies with other carbon transport proteins suggest:

    • Potential CO2-binding regions

    • Putative regulatory domains that may respond to pH changes

    • Possible interaction sites with other CCM components

Researchers investigating the structure-function relationship should consider:

  • Creating truncated versions to identify essential domains

  • Site-directed mutagenesis of conserved residues

  • Heterologous expression in systems lacking endogenous CCMs

  • Computational modeling based on the known sequence

How does cemA interact with other components of the carbon-concentrating mechanism in C. merolae?

Understanding cemA's interactions with other components of the carbon-concentrating mechanism is crucial for elucidating its precise role. Recent research has revealed:

  • Unique CCM in C. merolae: Unlike typical algal CCMs, C. merolae appears to lack a pyrenoid structure and does not efficiently uptake bicarbonate, suggesting a specialized CCM system .

  • Potential Interaction Partners: Several proteins may interact with cemA as part of the CCM network:

    • Carbonic anhydrases that catalyze the interconversion of CO2 and HCO3-

    • Other membrane transporters involved in inorganic carbon flux

    • Rubisco and associated proteins involved in carbon fixation

  • Integration with Photosynthetic Apparatus: The functional relationship between cemA and photosynthetic electron transport components remains to be fully characterized, but may involve:

    • Energetic coupling to power active transport

    • Regulatory feedback based on photosynthetic activity

    • pH-dependent mechanisms activated by light-driven proton gradients

Recommended experimental approaches include:

  • Protein-protein interaction studies (yeast two-hybrid, co-immunoprecipitation)

  • Comparative transcriptomics under varying CO2 conditions

  • Metabolic flux analysis using isotope labeling

  • In vitro reconstitution of minimum CCM components

What are the evolutionary implications of cemA conservation across red algae and other photosynthetic organisms?

The conservation of cemA across diverse photosynthetic lineages provides insights into the evolution of carbon-concentrating mechanisms:

  • Phylogenetic Distribution: Comparative genomic analyses reveal that cemA (ycf10) is present in the chloroplast genomes of red algae, glaucophytes, and most green algae and land plants, suggesting an ancient origin .

  • Sequence Divergence: Analysis of cemA across species shows varying degrees of conservation:

ComparisonAverage Pairwise Sequence DivergenceMost Divergent Regions
Within red algae0.003N-terminal domain
Between red and green algae0.0077Transmembrane domains
Across all photosynthetic lineagesVariableC-terminal region
  • Functional Evolution: The adaptation of cemA to different environmental niches provides a window into how photosynthetic organisms have evolved to maintain efficient carbon fixation:

    • Extremophilic adaptations in C. merolae (acid, heat)

    • Mesophilic adaptations in land plants

    • Aquatic adaptations in marine algae

Future research directions should include:

  • Comprehensive phylogenetic analysis of cemA across diverse photosynthetic organisms

  • Functional complementation studies across species

  • Investigation of selective pressures on different cemA domains

  • Correlation of sequence variations with habitat-specific adaptations

How should researchers interpret contradictory data regarding cemA function in different experimental systems?

When confronted with contradictory data about cemA function, researchers should apply a systematic approach to interpretation:

  • Evaluate Experimental Conditions:

    • Temperature and pH differences can significantly impact cemA function, given its extremophilic origin

    • CO2 concentration variations may trigger different regulatory mechanisms

    • Light conditions affect photosynthetic activity and could indirectly influence cemA function

  • Consider Expression System Limitations:

    • Heterologous expression may result in improper folding or post-translational modifications

    • Membrane integration efficiency varies between expression systems

    • Native interaction partners may be absent in recombinant systems

  • Examine Methodology Differences:

    • Direct measurement of cemA activity versus indirect functional assays

    • In vitro versus in vivo experimental approaches

    • Different detection methods may have varying sensitivities

When analyzing contradictory data, implement the following strategies:

  • Meta-analysis of multiple studies to identify patterns

  • Standardization of experimental conditions across laboratories

  • Development of consensus assays for cemA function

  • Collaborative cross-validation between research groups

What statistical approaches are most appropriate for analyzing cemA-related experimental data?

Selecting appropriate statistical methods is crucial for robust analysis of cemA-related data:

  • For Expression Optimization Studies:

    • Factorial design analysis to determine significant factors affecting expression

    • Response surface methodology to optimize multiple variables simultaneously

    • ANOVA to compare expression levels under different conditions

  • For Functional Analysis:

    • Regression analysis for dose-response relationships (e.g., CO2 concentration vs. uptake)

    • Time-series analysis for dynamic processes

    • Principal component analysis for multivariate data reduction

  • For Comparative Studies:

    • Paired t-tests for before/after comparisons

    • Non-parametric tests when assumptions of normality are violated

    • Multiple comparison corrections (e.g., Bonferroni, FDR) when testing multiple hypotheses

Sample size determination is critical and should be based on:

  • Preliminary estimates of effect size

  • Desired statistical power (typically 0.8 or higher)

  • Appropriate significance level (α, typically 0.05)

  • Expected variability in measurements

For complex experimental designs, consider consulting with a biostatistician during the planning phase rather than after data collection.

How can researchers integrate data from multiple experimental approaches to develop a comprehensive model of cemA function?

Developing a comprehensive model of cemA function requires integration of diverse data types:

  • Multi-omics Data Integration:

    • Genomic data: Sequence analysis and conservation patterns

    • Transcriptomic data: Expression patterns under different conditions

    • Proteomic data: Interaction partners and post-translational modifications

    • Metabolomic data: Carbon flux and photosynthetic outputs

  • Structural and Functional Correlation:

    • Mapping functional data onto structural predictions

    • Correlating mutagenesis results with specific domains or motifs

    • Integrating dynamics data with static structural information

  • Systems Biology Approaches:

    • Network analysis of cemA interactions within the CCM

    • Pathway modeling to simulate carbon flux

    • Predictive modeling of cemA behavior under varying conditions

A recommended integration framework includes:

Data TypeIntegration MethodOutput
Sequence & Structure3D modeling, conservation mappingStructural-functional domains
Expression & ActivityCorrelation analysis, clusteringRegulatory networks
Interaction & PathwayNetwork analysis, flux modelingSystem-level function
Evolutionary & ComparativePhylogenetic analysis, ancestral reconstructionEvolutionary trajectory

The integration process should be iterative, with new experimental data continuously refining the model and generating testable hypotheses for further investigation.

What emerging technologies could advance our understanding of cemA function?

Several cutting-edge technologies hold promise for elucidating cemA function:

  • CRISPR/Cas9 Gene Editing: Precise modification of cemA in its native context could reveal structure-function relationships without the limitations of heterologous expression .

  • Cryo-Electron Microscopy: High-resolution structural determination of cemA within its membrane environment could provide unprecedented insights into its functional mechanisms.

  • Single-Molecule Techniques: Monitoring individual cemA proteins could reveal dynamic behavior and heterogeneity not observable in bulk measurements.

  • Advanced Imaging Technologies:

    • Super-resolution microscopy for localization studies

    • Label-free imaging techniques to observe cemA in native state

    • Live-cell imaging to track dynamic processes

  • Synthetic Biology Approaches: Reconstitution of minimal CCM systems could allow systematic testing of cemA function in controlled environments.

Researchers should consider interdisciplinary collaborations to leverage these technologies effectively.

How might insights from cemA research be applied to enhance photosynthetic efficiency in other organisms?

Understanding cemA function in C. merolae could lead to several practical applications:

  • Engineering Enhanced Carbon Fixation: Transferring cemA or modified versions to crop plants could potentially:

    • Improve photosynthetic efficiency under limiting CO2 conditions

    • Enhance water-use efficiency by allowing stomata to remain partially closed

    • Increase crop yields in changing climatic conditions

  • Biofuel Production Optimization: Incorporating cemA into algal biofuel production systems may:

    • Enable cultivation in non-traditional environments (acid mine drainage, thermal vents)

    • Enhance carbon capture efficiency from industrial emissions

    • Improve biomass production rates

  • Synthetic Biology Applications: The thermostable and acid-resistant properties of cemA could be valuable for:

    • Creating robust biosensors for extreme environments

    • Developing biological carbon capture systems

    • Engineering novel CO2-concentrating mechanisms in synthetic organisms

Future research should focus on translational aspects while maintaining fundamental investigations into the mechanistic details of cemA function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.