Recombinant Cyanidioschyzon merolae Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. Specify your required tag type at the time of ordering for preferential development.
Synonyms
petD; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Cyanidioschyzon merolae (strain 10D) (Red alga)
Target Names
petD
Target Protein Sequence
MSILKKPDLSDAQLRAKLAKGMGHNMYGEPAWPNDLLYTFPVVILGTITCCIGLALMEPS AIGEAANPFATPLEILPEWYFYPTFNLLRVIPNKLLGVLSMASVPLGLIFVPFIENRNRY QNPWRRPIATTVFLVGTVVTIWLGIGATKSIQDAISLGLF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex. This complex facilitates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Database Links
Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Cyanidioschyzon merolae and why is it significant for photosynthesis research?

Cyanidioschyzon merolae is a unicellular primitive red alga classified under Cyanidiophyceae, representing a basal clade within the red lineage of plastids . This extremophilic microalga thrives in acidic hot springs and has several distinctive features that make it valuable for photosynthesis research:

  • It possesses a remarkably compact circular plastid genome of 149,987 bp containing 243 genes with no introns and minimal intergenic spaces

  • The genome exhibits unprecedented gene compaction, with approximately 40% of protein genes overlapping

  • It has a single chloroplast, mitochondrion, and nucleus per cell, simplifying organelle isolation and analysis

  • The complete genome sequence is available, facilitating genetic manipulation studies

  • Its phylogenetic position makes it valuable for understanding the evolution of photosynthetic mechanisms

These characteristics make C. merolae an excellent model organism for investigating fundamental aspects of photosynthesis, particularly the structure, function, and evolution of photosynthetic complexes like the cytochrome b6-f complex in red algae.

What is the cytochrome b6-f complex and what role does the petD subunit play?

The cytochrome b6-f complex is a crucial membrane protein complex in the photosynthetic electron transport chain that mediates electron transfer between Photosystem II and Photosystem I. This complex catalyzes plastoquinol oxidation and plastocyanin reduction while simultaneously translocating protons across the thylakoid membrane, contributing to the proton gradient used for ATP synthesis.

The petD gene encodes subunit 4 of this complex (also called subunit IV), which serves several critical functions:

  • Contributes to the structural integrity and stability of the entire cytochrome b6-f complex

  • Contains transmembrane helices that anchor the complex in the thylakoid membrane

  • Participates in forming the quinone binding sites essential for electron transport

  • May be involved in proton translocation pathways through the complex

  • Interacts with other subunits to maintain the proper architecture of the complex

Understanding the petD subunit's structure and function is essential for comprehending the mechanisms of photosynthetic electron transport in C. merolae, particularly how this organism has adapted these processes to function in extreme environments.

How is the petD gene organized in the C. merolae plastid genome?

In the highly compact plastid genome of C. merolae, the petD gene exhibits several notable organizational characteristics:

This compact organization reflects the extreme gene compression in the C. merolae plastid genome and presents both challenges and opportunities for genetic engineering approaches targeting the petD gene.

What are the most effective approaches for recombinant expression of C. merolae petD?

Recombinant expression of the C. merolae petD gene presents several challenges due to its membrane protein nature and involvement in a multi-subunit complex. Based on successful approaches with other C. merolae proteins, the following methodologies are recommended:

Heterologous Expression Systems:

Expression SystemAdvantagesConsiderations
E. coli- Rapid growth
- Well-established protocols
- Various specialized strains available
- Codon optimization required
- Membrane protein folding issues
- May need fusion partners
Yeast (P. pastoris)- Eukaryotic post-translational modifications
- Better membrane protein folding
- High cell density cultures
- Longer expression time
- More complex media requirements
- Different lipid environment
Cell-free systems- Avoids toxicity issues
- Direct incorporation into lipid environments
- Rapid optimization
- Higher cost
- Lower yields
- Technical complexity

When designing expression constructs, consider the approach used for the His6-tagged PsaD protein in C. merolae, which successfully utilized an N-terminal tag and the native chloroplast targeting sequence . For petD, similar strategies could be employed:

  • Design expression constructs with affinity tags (His6, Strep-tag II) positioned to minimize interference with function

  • Consider using solubility-enhancing fusion partners (MBP, SUMO) with cleavable linkers

  • If expressing in E. coli, optimize codons for the expression host while maintaining key structural elements

  • Co-express with chaperones to improve folding and stability

  • Use specialized membrane protein expression strains with modified lipid compositions

For homologous expression in C. merolae itself, adapt the transformation protocol described for His6-tagged PsaD, which successfully used polyethylene glycol-mediated transformation and selection with the URA marker .

What purification strategies are most suitable for recombinant C. merolae petD protein?

Purifying membrane proteins like the cytochrome b6-f complex subunit 4 requires specialized approaches to maintain structural integrity and function. Based on successful purification of other C. merolae membrane proteins, the following strategic workflow is recommended:

Step 1: Membrane Extraction and Solubilization

  • Use gentle cell disruption methods (French press, sonication) to prepare membrane fractions

  • Screen detergents for optimal solubilization (n-dodecyl-β-D-maltoside, digitonin, and LMNG are good candidates)

  • Optimize detergent concentration, buffer composition, pH, and ionic strength

Step 2: Affinity Chromatography

  • For His6-tagged constructs, use immobilized metal affinity chromatography (IMAC) with Ni-NTA resin similar to the approach used for His6-PsaD purification

  • Consider using Strep-tag II/Strep-Tactin systems as an alternative offering higher specificity

  • Include detergent in all buffers at concentrations above critical micelle concentration

Step 3: Additional Purification Steps

  • Size exclusion chromatography to remove aggregates and further purify protein-detergent complexes

  • Ion exchange chromatography as a polishing step if necessary

  • Consider using lipid nanodiscs or amphipols to improve stability during purification

Step 4: Quality Assessment

  • SDS-PAGE and western blotting to confirm identity and purity

  • Mass spectrometry for precise identification and detection of modifications

  • Circular dichroism to assess secondary structure integrity

  • Dynamic light scattering to evaluate homogeneity and detect aggregation

Purification Yields and Considerations:

Purification StepExpected RecoveryCritical Parameters
Membrane extraction90-95%Temperature, buffer composition
Detergent solubilization50-70%Detergent type, concentration
IMAC60-80%Imidazole concentration, flow rate
Size exclusion70-90%Buffer composition, loading concentration

This purification strategy should be optimized for the specific expression system used and may require significant troubleshooting to achieve high purity while maintaining the functional integrity of the petD protein.

What methods are most effective for analyzing the structure of recombinant C. merolae petD?

Structural characterization of the recombinant C. merolae petD protein requires a combination of computational and experimental approaches due to its membrane protein nature. The following methodological framework is recommended:

Computational Structure Analysis:

  • Sequence-based predictions:

    • Transmembrane domain prediction using TMHMM, MEMSAT, or TOPCONS

    • Secondary structure prediction with PSIPRED or JPred

    • Conservation analysis through multiple sequence alignment of petD from diverse organisms

    • Homology modeling based on existing cytochrome b6-f complex structures

Experimental Structure Determination:

  • X-ray crystallography:

    • Requires highly pure, homogeneous, and stable protein samples

    • Crystallization in lipidic cubic phases may be necessary for membrane proteins

    • Consider co-crystallization with antibody fragments to enhance crystal contacts

  • Cryo-electron microscopy:

    • Single-particle analysis for the entire cytochrome b6-f complex

    • Does not require crystallization

    • Can capture different conformational states

  • NMR spectroscopy:

    • Solution NMR for specific domains or peptide fragments

    • Solid-state NMR for the intact membrane protein

    • Provides dynamic information not easily obtained by other methods

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Maps solvent accessibility and structural dynamics

    • Particularly useful for identifying flexible regions and protein-protein interaction interfaces

    • Can be performed with relatively small amounts of protein

  • Crosslinking mass spectrometry:

    • Identifies spatial proximity between amino acid residues

    • Provides distance constraints for structural modeling

    • Especially valuable for mapping interactions with other subunits

When comparing the structure of C. merolae petD with homologs from other organisms, special attention should be paid to regions that might be adapted for function in extreme environments, such as the acidic hot springs where this organism naturally occurs.

How can we assess the functional activity of recombinant C. merolae petD within the cytochrome b6-f complex?

Evaluating the functional activity of recombinant C. merolae petD requires assessing its incorporation into the cytochrome b6-f complex and measuring electron transport activity. The following methodological approaches are recommended:

Complex Assembly Assessment:

  • Blue native PAGE:

    • Separates intact protein complexes according to size

    • Western blotting with anti-petD antibodies confirms incorporation

    • Second-dimension SDS-PAGE can resolve individual subunits

  • Sucrose gradient ultracentrifugation:

    • Separates complexes based on size and density

    • Fractions can be analyzed by SDS-PAGE and immunoblotting

    • Co-migration with other cytochrome b6-f subunits indicates proper assembly

  • Size exclusion chromatography:

    • Analyzes complex formation in solution

    • Can be coupled with multi-angle light scattering for molecular weight determination

    • Allows comparison between wild-type and recombinant complexes

Functional Activity Measurements:

Comparison of Activity Parameters:

Activity ParameterWild-type ComplexRecombinant ComplexMeasurement Method
Quinol oxidation rate150-200 μmol/mg·hVariable (target >70% of wild-type)Spectrophotometric assay
Plastocyanin reduction100-150 μmol/mg·hVariable (target >70% of wild-type)Absorption change at 597 nm
Proton translocation2 H+/e-Target: equivalent to wild-typepH indicator dyes in liposomes

These functional assays should be performed under various conditions (temperature, pH) to evaluate whether the recombinant petD retains the adaptations that allow C. merolae to function in its extreme native environment.

How can site-directed mutagenesis of C. merolae petD inform our understanding of electron transport mechanisms?

Site-directed mutagenesis of C. merolae petD provides a powerful approach for elucidating structure-function relationships in the cytochrome b6-f complex. This methodological framework enables systematic investigation of key residues:

Strategic Planning for Mutagenesis:

  • Identify target residues based on:

    • Sequence conservation analysis across diverse photosynthetic organisms

    • Structural information from homology models or existing structures

    • Predicted functional roles in electron transport or proton translocation

    • Unique residues in C. merolae that may contribute to extremophile adaptation

  • Design mutation types:

    • Conservative substitutions that maintain physicochemical properties

    • Non-conservative substitutions that alter charge, polarity, or size

    • Alanine scanning of specific regions to assess contribution to function

    • Introduction of spectroscopic or crosslinking probes at specific positions

Recommended Mutation Targets in petD:

Functional RegionTarget ResiduesMutation StrategyExpected Effect
Quinone binding siteConserved aromatics and polar residuesConservative and non-conservative substitutionsAltered quinol binding affinity
Transmembrane helicesHelix-helix interface residuesAlanine scanningDisrupted complex assembly
Stromal/lumenal loopsCharged residuesCharge reversalAltered interactions with electron carriers
Species-specific residuesUnique to C. merolaeSubstitution with equivalents from mesophilesReduced thermostability

Functional Analysis of Mutants:

  • Electron transport measurements:

    • Compare electron transfer rates between wild-type and mutant complexes

    • Measure kinetics of quinol oxidation and plastocyanin reduction

    • Determine effects on proton translocation efficiency

  • Spectroscopic analysis:

    • Electron paramagnetic resonance (EPR) to assess changes in cofactor environments

    • Time-resolved spectroscopy to measure electron transfer kinetics

    • Fluorescence resonance energy transfer (FRET) to evaluate conformational changes

  • Structural impact assessment:

    • Circular dichroism to detect changes in secondary structure

    • Limited proteolysis to identify alterations in protein folding

    • Thermal stability assays to measure effects on protein stability

Through systematic mutational analysis, researchers can map the electron and proton transfer pathways within the cytochrome b6-f complex and identify the molecular adaptations that allow C. merolae to maintain photosynthetic function under extreme conditions.

What approaches can be used to study protein-protein interactions involving C. merolae petD?

Investigating protein-protein interactions involving the C. merolae petD subunit requires specialized techniques suitable for membrane proteins. The following methodological approaches are recommended:

In Vivo Interaction Studies:

  • Genetic fusion approaches:

    • Split fluorescent protein complementation (BiFC) to visualize interactions

    • FRET-based approaches using fluorescent protein fusions

    • Protein-fragment complementation assays using reporter enzymes

  • Proximity-based labeling:

    • BioID or TurboID fusion to petD for proximity-dependent biotinylation

    • APEX2 fusion for proximity-dependent peroxidase labeling

    • Subsequent identification of labeled proteins by mass spectrometry

In Vitro Interaction Analysis:

  • Affinity-based methods:

    • Co-immunoprecipitation using antibodies against petD or putative interaction partners

    • Pull-down assays using tagged recombinant proteins

    • Surface plasmon resonance (SPR) to measure binding kinetics

  • Mass spectrometry-based approaches:

    • Crosslinking mass spectrometry (XL-MS) to identify interaction interfaces

    • Hydrogen-deuterium exchange mass spectrometry to map binding regions

    • Native mass spectrometry of intact complexes

Structural Validation:

  • Cryo-electron microscopy of reconstituted complexes

  • X-ray crystallography of co-crystals with interaction partners

  • NMR spectroscopy of labeled proteins to detect chemical shift perturbations upon binding

Expected Interaction Network for C. merolae petD:

Interaction PartnerFunctionDetection MethodValidation Approach
Other cytb6f subunits (petA, petB, petC)Complex assemblyBlue native PAGE, co-IPXL-MS, mutagenesis
Photosystem I componentsSupercomplex formationSucrose gradient centrifugationElectron microscopy
Photosystem II componentsSupercomplex formationChemical crosslinkingFunctional assays
Plastocyanin/cytochrome c6Electron transferSurface plasmon resonanceMutagenesis studies
Assembly factorsComplex biogenesisBioID proximity labelingGenetic knockdowns

These approaches can reveal how petD contributes to both structural organization and functional interactions within the photosynthetic electron transport chain of C. merolae, providing insights into the unique adaptations of this extremophilic organism.

How does the function of C. merolae petD adapt to extreme environmental conditions?

As an extremophilic organism adapted to acidic hot springs, C. merolae has evolved specialized adaptations in its photosynthetic apparatus, including the cytochrome b6-f complex. Understanding how petD functions under extreme conditions provides insights into molecular adaptation mechanisms. The following methodological approaches can address this question:

Temperature Adaptation Studies:

  • Comparative activity measurements:

    • Measure electron transfer rates of recombinant cytochrome b6-f complex at different temperatures (20-55°C)

    • Compare thermal stability of C. merolae petD with homologs from mesophilic species

    • Evaluate temperature dependence of quinol oxidation and plastocyanin reduction

  • Structural thermostability analysis:

    • Circular dichroism spectroscopy at increasing temperatures to determine melting temperatures

    • Differential scanning calorimetry to measure thermodynamic parameters of unfolding

    • Limited proteolysis at different temperatures to identify thermolabile regions

pH Adaptation Studies:

  • Functional analysis across pH gradients:

    • Measure electron transport activity at pH values ranging from 1.5 to 7.0

    • Determine optimal pH for C. merolae cytochrome b6-f complex function

    • Compare with homologs from neutrophilic organisms

  • Protonation state analysis:

    • Identify key residues involved in pH sensing using site-directed mutagenesis

    • Study pH-dependent conformational changes using H/D exchange mass spectrometry

    • Examine pH effects on protein-protein interactions within the complex

Comparative Adaptation Parameters:

ParameterC. merolae petDMesophilic HomologsAdaptation Significance
Optimal temperature40-45°C25-30°CThermostability adaptations
Thermal stability (Tm)65-75°C45-55°CEnhanced protein folding stability
Optimal pH2.0-3.06.0-7.0Acid-stable structural elements
Activity retention at pH 2>80%<20%Acid-resistant electron transport

These studies can reveal the molecular basis for the remarkable adaptation of C. merolae's photosynthetic apparatus to extreme conditions, potentially inspiring biomimetic approaches for engineering stress-tolerant photosynthetic systems.

What methods are most effective for studying the regulation of C. merolae petD expression under different environmental conditions?

Understanding how C. merolae regulates petD expression in response to environmental changes requires a comprehensive set of molecular and physiological approaches. The following methodological framework is recommended:

Transcriptional Regulation Analysis:

  • Quantitative gene expression studies:

    • RT-qPCR to measure petD transcript levels under various conditions

    • RNA-Seq for genome-wide expression profiling

    • Nuclear run-on assays to measure transcription rates

  • Promoter analysis:

    • Identification of regulatory elements in the petD promoter region

    • Reporter gene assays to assess promoter activity under different conditions

    • Chromatin immunoprecipitation (ChIP) to identify transcription factors binding to the promoter

Post-Transcriptional Regulation:

  • RNA stability assessment:

    • Measurement of mRNA half-life using transcription inhibitors

    • Analysis of RNA-binding proteins that interact with petD transcripts

    • Identification of potential regulatory RNA elements

  • Translational regulation:

    • Polysome profiling to assess translation efficiency

    • Ribosome profiling to identify translational pauses

    • Analysis of translation initiation factors under stress conditions

Environmental Response Experiments:

Environmental FactorExperimental RangeResponse ParametersMeasurement Methods
Temperature20-50°CTranscript levels, protein abundanceRT-qPCR, Western blot
pH1.0-7.0Gene expression, protein stabilityRNA-Seq, pulse-chase
Light intensity10-500 μmol photons/m²/sTranscription rate, protein turnoverNuclear run-on, proteomics
Nutrient limitationN, P, S, Fe deficiencyExpression patterns, complex assemblyRT-qPCR, Blue native PAGE
Oxidative stressH₂O₂, methyl viologenTranscript/protein levels, damage repairRNA-Seq, redox proteomics

Integration with Physiological Measurements:

  • Correlation of gene expression with photosynthetic parameters:

    • Oxygen evolution rates

    • Electron transport measurements

    • Photosystem stoichiometry adjustments

  • Analysis of long-term adaptation strategies:

    • Acclimation versus adaptation responses

    • Epigenetic regulation mechanisms

    • Comparative analysis with other extremophilic algae

These approaches can reveal how C. merolae regulates its photosynthetic apparatus in response to environmental challenges, providing insights into the remarkable adaptability of this extremophilic organism.

How can recombinant C. merolae petD be utilized in photosynthetic biohybrid systems?

The thermostable and acid-tolerant properties of C. merolae photosynthetic components make them particularly valuable for the development of robust biohybrid systems. Similar to the approach used with C. merolae Photosystem I , the cytochrome b6-f complex containing petD could be employed in creating stable bio-electronic interfaces:

Biohybrid System Design Strategies:

  • Direct electrode immobilization:

    • Introduction of cysteine residues in petD for thiol-gold surface attachment

    • His-tag mediated binding to Ni-NTA functionalized electrodes

    • Covalent attachment through EDC/NHS chemistry to carboxyl-functionalized surfaces

  • Integration with nanomaterials:

    • Attachment to graphene-based materials for enhanced electron transfer

    • Incorporation into semiconductor nanowires for light harvesting

    • Assembly with quantum dots for expanded spectral absorption

  • Construction of synthetic electron transport chains:

    • Connection with artificial reaction centers

    • Coupling with non-biological redox components

    • Integration with fuel-producing enzymes

Potential Applications:

ApplicationSystem ComponentsAdvantages of C. merolae petDPerformance Metrics
BiosensorspetD-modified electrodes with artificial mediatorsThermostability, pH toleranceSensitivity, detection range
BiophotovoltaicsComplete ETCs assembled on electrodesRobust electron transportPower density, stability
BiocatalysispetD-complex coupled with redox enzymesFunctioning in harsh conditionsTurnover frequency, product yield
Artificial photosynthesispetD connected to H₂-evolving catalystsEnhanced durabilityH₂ production rate, longevity

Similar to the genetically engineered PSI complex from C. merolae that was successfully employed as a photoactive component in an electrode system , the cytochrome b6-f complex containing the petD subunit could be engineered for optimal integration into biohybrid devices. The thermostability and acid tolerance of C. merolae components would be particularly valuable for applications requiring operation under harsh conditions or extended longevity.

What are the most promising research directions for understanding the evolution of petD in extremophilic red algae?

Investigating the evolution of petD in extremophilic red algae like C. merolae provides insights into adaptation mechanisms and the diversification of photosynthetic systems. The following research approaches offer promising directions:

Evolutionary Genomic Approaches:

  • Comparative sequence analysis:

    • Phylogenetic reconstruction using petD sequences from diverse algal lineages

    • Analysis of selection pressure (dN/dS ratios) across different domains of the protein

    • Identification of signatures of positive selection in extremophilic lineages

  • Ancestral sequence reconstruction:

    • Computational inference of ancestral petD sequences

    • Resurrection of ancestral proteins through gene synthesis and expression

    • Functional characterization of ancestral variants to trace evolutionary trajectories

  • Population genomics:

    • Sequencing petD from multiple strains of C. merolae and related species

    • Analysis of polymorphism patterns to identify recent selective events

    • Correlation of genetic variants with environmental parameters

Experimental Evolution Studies:

  • Laboratory evolution under extreme conditions:

    • Experimental evolution of mesophilic algae under increasing temperature/acidity

    • Tracking of molecular changes in petD and related genes

    • Functional characterization of evolved variants

  • Domain swapping experiments:

    • Creation of chimeric petD proteins combining domains from extremophilic and mesophilic species

    • Functional testing to map thermostability and acid tolerance determinants

    • Structural analysis of successful chimeras

Structural Evolution Analysis:

Evolutionary FeatureMethodological ApproachExpected Insights
Thermostability determinantsComparison of homology models with melting temperaturesKey residues contributing to thermal resistance
pH adaptation sitesAnalysis of titratable residues across speciesCritical positions for acid tolerance
Conserved functional motifsMutational scanning of highly conserved regionsEssential elements maintained through evolution
Lineage-specific adaptationsIdentification of uniquely conserved residues in CyanidiophyceaeRed algal adaptations to extreme environments

These research directions can contribute to our understanding of how photosynthetic complexes have adapted to extreme environments throughout evolutionary history, potentially revealing generalizable principles of protein adaptation that could inform protein engineering efforts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.