Recombinant Cyanidioschyzon merolae Cytochrome b6 (petB)

Shipped with Ice Packs
In Stock

Description

Table 1: Recombinant petB Variants

FeatureFull-Length (1-222aa) Partial (1-215aa)
Expression HostE. coliE. coli
TagN-terminal HisUndisclosed
Storage BufferTris-based + 50% glycerolTris-based + 50% glycerol
UniProt IDP28058Q85G16

Functional Role in Photosynthesis

The cytochrome b₆f complex, including petB, mediates electron transfer between Photosystem II (PSII) and Photosystem I (PSI) while generating a proton gradient for ATP synthesis . Key functional insights:

  • Electron Transport: Facilitates plastoquinol oxidation and plastocyanin reduction, critical for linear electron flow .

  • Regulatory Interactions: Peripheral subunits like PetP (SH3 fold) modulate complex stability and efficiency .

  • Mutational Studies: Loss of small subunits (e.g., PetN) destabilizes the complex, reducing oxygen evolution by 70% .

Production and Stability

Recombinant petB is sensitive to storage conditions:

  • Temperature: Stable at -20°C for short-term; long-term storage requires -80°C .

  • Buffer: Tris-based formulations with 50% glycerol prevent aggregation .

  • Freeze-Thaw Cycles: Repeated cycles degrade protein integrity .

Evolutionary and Genomic Context

  • Plastid Genome: C. merolae retains a compact plastid genome (149,987 bp) with overlapping genes (e.g., rps17 and rpl14 share 38 bp) .

  • Conservation: PetB homologs are part of the "photosynthetic gene set" shared across cyanobacteria, red algae, and plants .

  • Sulfate Transport: The plastid genome encodes cysT and cysW, suggesting adaptations to high-sulfur environments .

Research Applications

  • Electron Transport Studies: Used to dissect mechanisms of photosynthetic regulation .

  • Antibody Development: Serves as an antigen for antibodies validating PSI/PSII interactions .

  • Structural Biology: NMR and crystallography studies resolve interaction surfaces (e.g., PetP’s SH3 domain) .

Table 2: Cytochrome b₆f Complex Subunits

SubunitRoleConservation
PetBCore transmembrane componentCyanobacteria, algae, plants
PetDStabilizes complex assemblyCyanobacteria, red algae
PetNEnhances complex stabilityCyanobacteria only

Future Directions

  • Structural Dynamics: High-resolution studies of petB’s quinone-binding sites .

  • Biotechnological Engineering: Optimizing electron transport in synthetic photosynthetic systems .

  • Evolutionary Adaptations: Exploring C. merolae’s extremophile adaptations via plastid genomics .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary based on your purchasing method and location. For specific delivery time estimates, please contact your local distributor.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
The shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize development based on your specification.
Synonyms
petB; Cytochrome b6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Cyanidioschyzon merolae (strain 10D) (Red alga)
Target Names
petB
Target Protein Sequence
MSKVYDWFQERLSIQDIADDITSKYVPPHVNIFYCLGGMTLTCFLVQVATGFAMTFYYRP TVAEAFSSVEYMMTQVNFGWLIRSLHRWSASMMVLMMILHIFRVYLTGGFKKPRELTWIT GVILGVLTVSFGVTGYSLPWDQVGYWACKIVTGVPEAIPVVGSSLVELLRGDVSVGQATL TRFYSLHTLVLPVLSLVFMLAHFLMIRKQGISGPL
Uniprot No.

Target Background

Function
Cytochrome b6 is a key component of the cytochrome b6-f complex. This complex plays a crucial role in mediating electron transfer between photosystem II (PSII) and photosystem I (PSI), facilitating cyclic electron flow around PSI, and regulating state transitions.
Database Links
Protein Families
Cytochrome b family, PetB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Cyanidioschyzon merolae and why is it valuable as a model organism for cytochrome b6 studies?

Cyanidioschyzon merolae is a unicellular red alga classified as a polyextremophile that thrives in environments with low pH (0.5-2.5) and high temperatures (42-50°C). It has emerged as an important model organism for studying organelle division and inheritance due to its extremely simple cellular structure, consisting of only one nucleus, one mitochondrion, and one chloroplast, with completely sequenced genomes for all three .

The organism was originally isolated from the Phelgrean fields near Naples, Italy and has several advantages for cytochrome b6 studies, including its simplified genomic structure, well-established cultivation protocols, and growing toolkit for genetic manipulation . Its biomass contains valuable metabolites such as thermostable phycocyanin, starch, β-glucan, β-carotene, and zeaxanthin carotenoid pigments, making it biochemically interesting as well .

What is the function of cytochrome b6 in photosynthetic electron transport?

Cytochrome b6, encoded by the petB gene, is a crucial component of the cytochrome b6f complex, which functions as an electron carrier between photosystem II (PSII) and photosystem I (PSI) in the photosynthetic electron transport chain . This electron transfer through the cytochrome b6f complex is coupled with proton translocation across the thylakoid membrane, contributing to the generation of an electrochemical gradient that drives ATP synthesis .

The cytochrome b6f complex exists as a dimer in its native form, with each monomer containing eight subunits . Disruption of cytochrome b6 function, as demonstrated in various mutant studies, leads to impaired photosynthetic capacity, highlighting its essential role in photosynthetic electron flow .

What cultivation methods are recommended for growing Cyanidioschyzon merolae under laboratory conditions?

For optimal laboratory cultivation of C. merolae, the following protocol has been established:

  • Maintain cultures in MA2 liquid medium at pH 2.3 (adjusted with H2SO4) in Erlenmeyer flasks.

  • Provide continuous white light at approximately 90 μmol photon m−2 s−1.

  • Maintain temperature at 42°C in an algae incubator.

  • Supplement with 4% CO2 in air mixtures.

  • Agitate cultures at 100 rpm for proper gas exchange .

For preculturing prior to growth analysis, inoculate cells into shake flasks with MA2 medium for 96 hours . When scaling up to larger volumes, a stepped approach is recommended, beginning with smaller volumes before transferring to larger photobioreactors.

How can researchers effectively extract and quantify components from C. merolae biomass?

A multi-assay procedure has been optimized for C. merolae to quantify various cellular components:

For pigment extraction:

  • Resuspend freeze-dried microalgal pellets (1.5-2 mg) in phosphate buffer (pH 7.4).

  • Add a 2:1 mixture of chloroform with methanol for phase separation.

  • After centrifugation, determine chlorophyll and carotenoid concentrations using spectrophotometric methods .

For phycocyanin extraction:

  • Harvest 1 mL of microalgal cell suspension and centrifuge for 5 min at 2,500 × g at 4°C.

  • Wash the biomass three times with acidified water (pH 2.5).

  • Add 1 mL of water to the wet biomass.

  • Subject the sample to four consecutive freezing (-20°C) and thawing (4°C) cycles for cell disruption.

  • Vortex and centrifuge at 10,000 × g for 10 min to remove cell debris.

  • Quantify the extracted phycocyanin using spectrophotometry, measuring optical density at 455, 564, 592, 618, and 645 nm .

What genetic manipulation techniques are available for C. merolae and how can they be applied to cytochrome b6 studies?

Recent advances have established reliable gene targeting methods for C. merolae. Two primary selection markers have been characterized:

  • URA Cm-Gs: A chimeric URA5.3 gene from C. merolae and Galdieria sulphuraria.

  • URA Cm-Cm: The authentic C. merolae URA5.3 gene .

Research indicates that using the authentic URA5.3 gene (URA Cm-Cm) results in more efficient single-copy insertion at targeted loci, while the chimeric marker tends to cause multicopy insertion at high frequencies with undesired recombination events . This finding is crucial for researchers planning gene targeting experiments with the petB gene.

These genetic tools enable several manipulation approaches:

  • Targeted gene disruption

  • Gene replacement

  • Protein tagging

  • Site-directed mutagenesis

For petB studies specifically, researchers can use these techniques to introduce specific mutations, create knockout lines, or add reporter tags to study cytochrome b6 assembly and function in vivo.

How do mutations in the petB gene affect cytochrome b6f complex assembly and function?

Studies in the related alga Chlamydomonas reinhardtii have demonstrated that specific mutations in the petB gene can severely impact cytochrome b6f complex assembly. When a proline codon was introduced in place of a leucine codon at position 204 of the petB gene, the resulting mutants were non-phototrophic and displayed blocked photosynthetic electron transfer, consistent with a lack of cytochrome b6f activity .

The primary defect was found to be at the level of assembly of apocytochrome b6 with the bh heme, which prevented assembly of the entire cytochrome b6f complex . This suggests that amino acid substitutions in critical regions of cytochrome b6 can disrupt the proper folding and/or heme incorporation necessary for complex assembly.

When working with recombinant cytochrome b6 in C. merolae, researchers should consider the following potential consequences of mutations:

  • Altered heme binding properties

  • Impaired protein-protein interactions within the complex

  • Destabilization of the protein structure

  • Changes in electron transfer kinetics in successfully assembled complexes

What nuclear-encoded factors are necessary for cytochrome b6f complex biogenesis in photosynthetic organisms?

Several nuclear-encoded factors have been identified as essential for cytochrome b6f complex biogenesis. One well-characterized factor is HCF153, a 15 kDa protein containing a chloroplast transit peptide that is tightly associated with the thylakoid membrane .

The protein could be involved in:

  • Assembly of the cytochrome b6f complex

  • Stabilization of complex components

  • Insertion of cofactors such as heme or iron-sulfur clusters

  • Translation of small subunits of the complex

Sequence similarity searches indicate that HCF153 is restricted to higher plants, suggesting that alternative factors might perform similar functions in algae like C. merolae .

What considerations are important when designing experiments to express recombinant cytochrome b6 in C. merolae?

When designing experiments for recombinant cytochrome b6 expression in C. merolae, researchers should consider:

1. Selection marker choice:
The authentic URA5.3 gene (URA Cm-Cm) is strongly recommended over the chimeric URA Cm-Gs marker to achieve single-copy insertion and avoid undesired recombination events .

2. Growth conditions optimization:
Culture C. merolae under its optimal growth conditions: pH 0.5-2.5, temperature 42-50°C, and continuous light (~90 μmol photon m−2 s−1) .

3. CO2 supplementation strategies:
Different CO2 supplementation strategies can significantly impact growth rates:

CO2 SourceGrowth ImpactApplication
Commercial pure CO2High biomass yieldLaboratory-scale studies
Green CO2 from flue gasModerate yieldPotential for large-scale cultivation
Air (0.04% CO2)Lower growth rateControl conditions

4. Expression cassette design:
Include C. merolae-specific promoters and terminators compatible with its extreme growth conditions. Consider codon optimization based on C. merolae's unique codon usage patterns.

5. Protein extraction and purification:
Develop extraction protocols specific to the thermoacidophilic nature of C. merolae. Consider including heat treatment steps that may denature contaminant proteins while preserving the thermostable target protein.

How can researchers analyze and interpret potential RNA editing events in C. merolae petB transcripts?

RNA editing is an important post-transcriptional modification observed in some photosynthetic organisms. While RNA editing of the petB transcript has been documented in plants like maize and tobacco (where proline codons are edited to leucine codons at specific positions), evidence suggests that C. reinhardtii does not perform similar editing at the same position .

For analyzing potential RNA editing in C. merolae petB transcripts, researchers should:

  • Compare genomic and cDNA sequences:

    • Extract genomic DNA and total RNA from C. merolae cultures

    • Perform RT-PCR on RNA samples to generate cDNA

    • Sequence both genomic DNA and cDNA of the petB gene

    • Compare sequences to identify potential differences indicating editing events

  • Employ high-throughput sequencing:

    • RNA-Seq can provide comprehensive coverage of the transcriptome

    • Compare RNA-Seq reads to the reference genome to identify potential editing sites

    • Validate promising candidates with targeted RT-PCR and Sanger sequencing

  • Examine editing under different growth conditions:

    • RNA editing patterns may change under different environmental stresses

    • Test multiple growth conditions (temperature, pH, light intensity)

    • Compare editing frequencies across conditions

  • Consider the functional impact:

    • Use site-directed mutagenesis to mimic potential RNA editing events

    • Assess the functional consequences on protein assembly and activity

    • Compare with known editing events in other species

What structural features are critical for cytochrome b6 function and how do they compare across species?

Cytochrome b6 functions as part of the dimeric cytochrome b6f complex, which is essential for electron transfer in photosynthetic organisms . Critical structural features include:

  • Heme binding sites: Cytochrome b6 contains multiple heme groups, including the bh heme, which is essential for proper assembly of the complex. Studies in C. reinhardtii have shown that disruption of heme attachment prevents assembly of the complete cytochrome b6f complex .

  • Transmembrane domains: The protein spans the thylakoid membrane, with specific residues positioned to facilitate electron transfer across the membrane.

  • Conserved amino acid residues: Position 204 in C. reinhardtii (where a leucine is critical) appears to be a highly sensitive site, as substitution with proline prevents proper assembly with the bh heme . This suggests that certain amino acid positions are crucial for maintaining the structural integrity required for heme incorporation.

When comparing cytochrome b6 across species, researchers should focus on these conserved features while noting species-specific adaptations that may relate to the organism's environmental niche, such as the extreme conditions tolerated by C. merolae.

What methodology should be employed to study electron transfer kinetics in recombinant cytochrome b6?

To study electron transfer kinetics in recombinant cytochrome b6 from C. merolae, researchers should consider the following methodological approaches:

  • Absorption spectroscopy:

    • Monitor the redox state changes of the heme groups

    • Use time-resolved spectroscopy to measure electron transfer rates

    • Compare kinetics under different conditions (pH, temperature, ionic strength)

  • Electrochemical techniques:

    • Protein film voltammetry to determine redox potentials

    • Measure electron transfer rates at different applied potentials

    • Evaluate the effects of mutations on electrochemical properties

  • Flash photolysis:

    • Use laser flash photolysis to initiate electron transfer reactions

    • Monitor the kinetics of electron transfer through transient absorption changes

    • Determine rate constants for different steps in the electron transfer pathway

  • In vitro reconstitution:

    • Incorporate purified recombinant cytochrome b6 into liposomes

    • Measure electron transfer between reconstituted photosystems

    • Evaluate the function of the recombinant protein in a near-native environment

Each technique provides complementary information about electron transfer processes, and combining multiple approaches can provide a more complete understanding of cytochrome b6 function.

What biotechnological applications could benefit from research on recombinant C. merolae cytochrome b6?

Research on recombinant C. merolae cytochrome b6 has potential applications in several biotechnological fields:

  • Biofuel production:

    • Engineering enhanced photosynthetic efficiency through optimized electron transport

    • Developing thermostable photosynthetic systems for high-temperature bioreactors

    • Creating acid-tolerant strains for cultivation in extreme conditions

  • Biosensors:

    • Utilizing the electron transfer properties of cytochrome b6 to develop redox-based biosensors

    • Creating thermostable biosensors that function under harsh conditions

    • Developing systems for detecting environmental pollutants or monitoring bioremediation processes

  • Synthetic biology:

    • Incorporating thermostable components from C. merolae into synthetic electron transport chains

    • Engineering minimal photosynthetic systems for specialized applications

    • Developing orthogonal electron transport systems for synthetic biology applications

  • Protein engineering:

    • Using insights from C. merolae's adaptations to develop proteins with enhanced thermostability

    • Engineering cytochrome variants with altered redox potentials or substrate specificities

    • Creating chimeric proteins with novel functions by combining domains from different species

The extreme conditions in which C. merolae thrives make its proteins particularly valuable for applications requiring stability under harsh conditions.

How can the cultivation conditions for C. merolae be optimized for maximum cytochrome b6 production?

Optimizing C. merolae cultivation for maximum cytochrome b6 production requires careful consideration of multiple parameters:

  • Temperature optimization:

    • While C. merolae grows optimally between 42-50°C, the specific temperature for maximum cytochrome b6 expression may differ

    • Implement temperature gradient studies to identify the optimal temperature for protein expression

    • Consider temperature shifts during cultivation (e.g., growth phase at one temperature, induction phase at another)

  • pH control:

    • Maintain pH between 0.5-2.5, but determine the optimal pH specifically for cytochrome b6 expression

    • Monitor pH changes during cultivation and implement control strategies

    • Investigate the effect of pH fluctuations on protein stability and function

  • Light intensity and quality:

    • Test different light intensities and spectral compositions for their effect on cytochrome b6 expression

    • Consider light/dark cycles versus continuous illumination

    • Implement strategies to prevent photoinhibition at high light intensities

  • Carbon dioxide supplementation:

    • Compare different CO2 sources and concentrations for their impact on growth and protein expression

    • Consider the trade-offs between biomass production and protein expression

    • Optimize CO2 delivery systems for efficient gas exchange

  • Nutrient composition:

    • Modify MA2 medium components to enhance cytochrome b6 expression

    • Consider supplementation with specific trace elements that may be cofactors

    • Test different nitrogen and phosphorus ratios for their effect on protein expression

A factorial experimental design approach is recommended to efficiently identify optimal conditions for cytochrome b6 production, as these parameters may have interactive effects.

What are common challenges in genetic manipulation of C. merolae and how can they be addressed?

Researchers working with C. merolae genetic manipulation often encounter several challenges:

  • Undesired recombination events:

    • Problem: The chimeric URA Cm-Gs selection marker can cause multicopy insertion and undesired recombination

    • Solution: Use the authentic URA5.3 gene (URA Cm-Cm) as a selection marker for more reliable single-copy insertion

  • Variable transgene expression:

    • Problem: Copy number variation leads to uneven levels of transgene expression

    • Solution: Confirm single-copy insertion through Southern blot analysis and select clones with consistent expression levels

  • Extreme growth conditions:

    • Problem: Standard laboratory equipment may not be suitable for C. merolae's acidic, high-temperature growth conditions

    • Solution: Use acid-resistant cultivation vessels and ensure temperature control systems can maintain the required 42-50°C range

  • Transformation efficiency:

    • Problem: Low transformation efficiency compared to other model organisms

    • Solution: Optimize DNA delivery methods, including electroporation parameters or alternative methods specifically adapted for extremophiles

  • Gene targeting specificity:

    • Problem: Off-target effects or incomplete targeting

    • Solution: Design targeting constructs with longer homology arms (>1 kb on each side) and carefully validate targeting using PCR and sequencing approaches

Addressing these challenges requires careful experimental design and validation at each step of the genetic manipulation process.

What strategies can be employed when recombinant cytochrome b6 fails to assemble properly in expression systems?

When recombinant cytochrome b6 fails to assemble properly, researchers can implement the following strategies:

  • Co-expression of assembly factors:

    • Identify and co-express potential assembly factors like HCF153 or functional homologs

    • Include chaperones that may facilitate proper protein folding

    • Co-express heme biosynthesis enzymes to ensure adequate cofactor availability

  • Modification of expression conditions:

    • Reduce expression temperature to slow protein synthesis and allow more time for proper folding

    • Adjust induction timing and intensity to prevent overwhelming the assembly machinery

    • Test different growth media formulations that may provide necessary cofactors

  • Protein engineering approaches:

    • Introduce stabilizing mutations based on structural analysis

    • Create fusion proteins with solubility-enhancing tags

    • Design truncated versions that retain critical functional domains

  • Alternative host systems:

    • Test expression in different strains or species that may provide a more suitable environment

    • Consider cell-free expression systems that can be supplemented with necessary components

    • Explore heterologous expression in photosynthetic organisms that naturally contain the cytochrome b6f complex

  • Analysis of failure points:

    • Implement pulse-chase experiments to track protein synthesis and degradation

    • Use tagged versions of cytochrome b6 to monitor subcellular localization

    • Perform co-immunoprecipitation to identify interacting partners or assembly intermediates

Lessons from studies in C. reinhardtii suggest paying particular attention to amino acid positions that may affect heme incorporation, as this appears to be a critical step in proper assembly of the cytochrome b6f complex .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.