Recombinant Cyanidioschyzon merolae Photosystem I assembly protein Ycf4 (ycf4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ycf4; Photosystem I assembly protein Ycf4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-164
Protein Length
full length protein
Species
Cyanidioschyzon merolae (strain 10D) (Red alga)
Target Names
ycf4
Target Protein Sequence
MSIQRESIIGSRRWSNMIWCAILVTAGSGFWFNGMQSELALQGAIMCFYGSVAVTLSVYL FLTIWWDVGGGYNEYDTENKSITIWRRGFGNKTIFLKYTRDQMQALKVVVKDGLNPKREI YLCTTTGAQIPLTAVGEPMPLAELEQKATQLAQWLNLSLVGMRA
Uniprot No.

Target Background

Function
Essential for the assembly of the photosystem I complex.
Database Links
Protein Families
Ycf4 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Cyanidioschyzon merolae and why is it a valuable model organism?

C. merolae is an extremophilic unicellular red alga that thrives in acidic hot springs with low pH (0.2-4) and high temperatures (40-56°C). It possesses exceptionally simple cellular architecture, with a single chloroplast, mitochondrion, and nucleus. Its complete genome sequencing (nuclear, plastid, and mitochondrial), established transformation methods, and ability to synchronize its cell cycle via light-dark cycles make it an excellent model organism for fundamental biological studies . The simplicity of C. merolae, combined with its early evolutionary divergence in eukaryotic evolution, provides unique insights into basic cellular processes.

What is the Ycf4 protein and where is it encoded in C. merolae?

Ycf4 is a protein encoded by the ycf4 gene located in the plastid genome of C. merolae. The C. merolae plastid genome is a circular DNA molecule of 149,987 bp with no inverted repeats . This protein is involved in the assembly of Photosystem I (PSI), a critical complex in the photosynthetic machinery. In C. merolae, as in other photosynthetic organisms, the ycf4 gene is part of the highly compact plastid genome, which features very short intergenic distances and overlapping genes—approximately 40% of protein-coding genes overlap in this organism .

What is the relationship between Ycf4 and photosynthesis in C. merolae?

Ycf4 functions as an assembly factor for Photosystem I in C. merolae. Research has shown that Ycf4 is part of a large complex (>1500 kD) that contains PSI subunits including PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF . Through pulse-chase protein labeling experiments, it has been demonstrated that the PSI polypeptides associated with the Ycf4-containing complex are newly synthesized, supporting its role in PSI assembly rather than in mature PSI complexes . C. merolae contains only chlorophyll a, which primarily absorbs blue and red light, and employs phycobilisomal antennae for light harvesting in other spectral regions .

What is the molecular structure of the Ycf4 protein in C. merolae?

The Ycf4 protein in C. merolae is a membrane-integrated protein with multiple transmembrane domains. While the exact structure of C. merolae Ycf4 has not been fully resolved in atomic detail, comparative analysis with related proteins suggests a structure with several membrane-spanning regions. The carboxyl terminus of Ycf4 appears particularly important for its function, as it interacts strongly with Photosystem I subunits such as PsaB, PsaC, and PsaH, as well as with light-harvesting complexes (LHC) . These interactions have been identified through in silico studies and supported by functional analyses.

How does the Ycf4 complex assemble in C. merolae?

The Ycf4 protein in C. merolae forms part of a large complex exceeding 1500 kD in size. Electron microscopy has revealed that the largest structures in purified Ycf4 complex preparations measure approximately 285 × 185 Å, potentially representing various oligomeric states . Biochemical studies using tandem affinity purification (TAP) tagging have demonstrated that Ycf4 intimately and exclusively associates with an opsin-related protein called COP2. This association is highly stable, as almost all Ycf4 and COP2 in wild-type cells copurify through sucrose gradient ultracentrifugation and subsequent ion exchange column chromatography .

What other proteins interact with Ycf4 during PSI assembly?

Ycf4 interacts with numerous proteins during PSI assembly. Mass spectrometry and immunoblotting analyses have identified several PSI subunits (PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF) that associate with the Ycf4-containing complex . Additionally, in silico studies suggest interactions between Ycf4 and both the large (chloroplast-encoded) and small (nuclear-encoded) subunits of RuBisCO, further indicating Ycf4's broader role in coordinating photosynthetic machinery assembly . The COP2 protein, which has opsin-related functions, is another key interaction partner that appears to be consistently associated with Ycf4.

How can recombinant Ycf4 from C. merolae be expressed and purified?

Recombinant expression of C. merolae Ycf4 can be achieved using heterologous expression systems, primarily in E. coli. Based on protocols used for similar proteins like the Solanum lycopersicum Ycf4, the general methodology involves:

  • Cloning the full-length ycf4 gene from C. merolae into an appropriate expression vector

  • Introducing a purification tag (typically His-tag) at either the N or C terminus

  • Expressing the protein in E. coli using optimized conditions

  • Purifying the protein using affinity chromatography

The purified protein is typically stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0 and should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol for long-term storage at -20°C/-80°C .

What techniques are effective for studying Ycf4-PSI interactions in C. merolae?

Several complementary techniques have proven effective for investigating Ycf4-PSI interactions:

TechniqueApplicationAdvantagesLimitations
Tandem Affinity Purification (TAP)Isolation of native Ycf4 complexesMaintains native interactionsMay affect protein function if tag interferes
Mass Spectrometry (LC-MS/MS)Identification of complex componentsHigh sensitivity, comprehensiveSample preparation can affect results
Pulse-Chase Protein LabelingTracking newly synthesized proteinsShows dynamic assemblyLabor-intensive
Electron MicroscopyVisualization of complex structureDirect observationLimited resolution for smaller complexes
Sucrose Gradient UltracentrifugationSeparation of complexes by sizeMaintains native associationsLimited resolution between similar-sized complexes
ImmunoblottingSpecific protein detectionHigh specificityLimited to available antibodies

For optimal results, these techniques should be used in combination to provide complementary data on structure, composition, and dynamics of the Ycf4-PSI assembly process .

How can genetic manipulation of the ycf4 gene be achieved in C. merolae?

Genetic manipulation of the ycf4 gene in C. merolae requires specialized approaches due to its location in the plastid genome. The complete knockout of ycf4 can be achieved using plastid transformation techniques. The transformation methods for C. merolae are well established, and the cell cycle can be synchronized by light/dark cycles, facilitating transformation experiments . Key methodological steps include:

  • Design of knockout constructs with appropriate selectable markers

  • Delivery of DNA by particle bombardment or other suitable methods

  • Selection of transformants on appropriate media

  • Verification of homoplasmy (complete replacement of all wild-type copies)

  • Phenotypic characterization under various growth conditions

It's crucial to note that full deletion of the ycf4 gene renders plants unable to grow photoautotrophically, requiring supplementation with an external carbon source such as sucrose (30 g/L) for survival .

How does the function of Ycf4 in C. merolae compare to its role in other photosynthetic organisms?

The function of Ycf4 varies significantly across different photosynthetic organisms. In tobacco, for example, complete deletion of the ycf4 gene prevents photoautotrophic growth, whereas partial deletions (particularly those preserving the carboxyl terminus spanning 91 amino acids) allow plants to grow photoautotrophically . In contrast, cyanobacterial mutants deficient in Ycf4 can still assemble PSI complexes, albeit at reduced levels .

These differences suggest evolutionary divergence in the mechanism of PSI assembly. C. merolae, as a member of the Cyanidiophyceae (which represents a basal clade within red lineage plastids), may provide insights into ancestral functions of Ycf4 . Comparative studies between C. merolae Ycf4 and its homologs in other species can illuminate the evolution of PSI assembly mechanisms across photosynthetic lineages.

What is the role of the carboxyl terminus of Ycf4 in C. merolae?

The carboxyl terminus of Ycf4 plays a critical role in protein-protein interactions essential for photosynthetic machinery assembly. In silico studies have revealed that the carboxyl terminus of Ycf4 interacts more strongly with Photosystem I subunits (including PsaB, PsaC, and PsaH) and light-harvesting complexes than its amino terminus . Similarly, the carboxyl terminus shows significant interaction with both the large and small subunits of RuBisCO.

These findings explain why partial deletions of Ycf4 that preserve the carboxyl terminus may allow for photoautotrophic growth, while complete deletions of the ycf4 gene render organisms unable to grow without an external carbon source. The carboxyl terminus appears to be the functional core of the protein, mediating critical interactions necessary for proper assembly of the photosynthetic apparatus .

How does light quality and intensity affect Ycf4 expression and function in C. merolae?

C. merolae contains only chlorophyll a, which primarily absorbs blue and red light, complemented by phycobilisomal antennae that can absorb light in the yellow part of the spectrum . Research has shown that photosynthesis and CO₂ absorption in C. merolae reach approximately half the efficiency in both red and blue light compared to white light of the same intensity .

Studies on C. merolae growth under different light qualities (white, blue, yellow, and red) and intensities (25, 50, 100, and 250 μmol photon m⁻² s⁻¹) have demonstrated specific adaptation patterns . While these studies didn't specifically focus on Ycf4, the differential growth responses suggest potential light-dependent regulation of photosynthetic machinery assembly, including the Ycf4-mediated assembly of PSI. Further research is needed to directly measure Ycf4 expression and activity under various light conditions.

How do we reconcile contradictory findings about Ycf4 essentiality?

This contradiction can be reconciled by considering the importance of the carboxyl terminus of Ycf4. The tobacco mutants that retained the carboxyl terminus (spanning 91 amino acids) could grow photoautotrophically, while those with complete deletion could not. This suggests that the carboxyl terminus contains the essential functional domains for Ycf4's role in photosynthesis . Future research should focus on detailed structure-function analysis of different Ycf4 domains.

What evolutionary insights can C. merolae Ycf4 provide about photosynthetic apparatus assembly?

C. merolae belongs to Cyanidiophyceae, which phylogenetic analyses have identified as a basal clade within the red lineage plastids . This evolutionary positioning makes C. merolae Ycf4 particularly valuable for understanding the ancestral functions and evolutionary trajectory of PSI assembly factors.

Comparative genomic and functional studies between C. merolae Ycf4 and its homologs in cyanobacteria, other algae, and land plants could illuminate how PSI assembly mechanisms have evolved. Of particular interest would be identifying conserved domains and interaction networks that have remained unchanged throughout evolution versus those that have diverged. This research direction could provide fundamental insights into the evolution of photosynthetic machinery.

What are promising approaches for future studies of Ycf4 in C. merolae?

Future studies on C. merolae Ycf4 should integrate multiple cutting-edge approaches:

  • Cryo-EM Analysis: High-resolution structural studies of the Ycf4-containing complex would provide unprecedented insights into its architecture and function.

  • Interactome Mapping: Comprehensive identification of all proteins interacting with Ycf4 throughout the cell cycle and under various environmental conditions.

  • Domain-Specific Mutagenesis: Systematic alteration of specific amino acids or domains to identify critical functional regions.

  • In vivo Imaging: Tracking Ycf4 localization and dynamics during PSI assembly using fluorescent tags and advanced microscopy.

  • Comparative Omics: Integrating transcriptomics, proteomics, and metabolomics data from wild-type and ycf4 mutants under various conditions.

  • Heterologous Expression Studies: Testing the ability of C. merolae Ycf4 to complement ycf4 mutations in other organisms and vice versa.

These approaches would address fundamental questions about the mechanism of Ycf4-mediated PSI assembly and potentially reveal novel functions of this protein in photosynthetic organisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.