Recombinant Cyanidioschyzon merolae Photosystem I reaction center subunit XI (psaL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.

Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.

Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.

Tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.

Synonyms
psaL; Photosystem I reaction center subunit XI; PSI subunit V; PSI-L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-140
Protein Length
full length protein
Species
Cyanidioschyzon merolae (strain 10D) (Red alga)
Target Names
psaL
Target Protein Sequence
MTDYIKPYNNDPFVGHLATPINSSSLTRAYLSQLPIYRRGVSPFLRGLEIGMAHGYFLIG PFVQLGPLRNTDIKYLAGLLSAIGLIVILTLGMLLYGAVSFTNDSQDLESVDGWRQLASG FLLGAVGGAGFAYLLLTLFS
Uniprot No.

Target Background

Database Links
Protein Families
PsaL family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What growth conditions are optimal for cultivating Cyanidioschyzon merolae for PSI isolation?

Optimal cultivation of C. merolae requires specialized conditions that reflect its extremophilic nature. Standard laboratory cultivation should be performed at 40°C under continuous white light (50 μmol m⁻² s⁻¹) in liquid MA2 medium maintained at pH 2.5 . The medium should be bubbled with air supplemented with 2% (v/v) CO₂ to ensure adequate carbon supply for photosynthesis and growth . For scaled-down cultivation in multiwell plates, adjust light intensity to 20 μmol m⁻² s⁻¹ and increase CO₂ concentration to 5% (v/v) . These precise growth parameters are essential for obtaining healthy cells with fully functional photosynthetic complexes, which directly impacts the quality and yield of recombinant PsaL protein.

How does the genomic context of the psaL gene in C. merolae affect recombinant expression strategies?

The C. merolae genome exhibits remarkable compactness with approximately 40% of protein-coding genes overlapping, which is significantly higher than other plastid genomes . This genomic condensation creates unique challenges for recombinant expression. When designing expression constructs for the psaL gene, researchers must carefully consider the potential overlap with adjacent genes, as improper sequence selection may result in truncated or chimeric proteins. In some cases, neighboring genes may share as much as 38 base pairs, as demonstrated in other overlapping gene pairs in the C. merolae genome . Expression strategies should therefore incorporate complete gene context analysis and potentially include extended flanking regions to ensure proper expression and folding of the recombinant PsaL protein.

What expression systems are most effective for producing functional recombinant C. merolae PsaL, and what purification strategies maintain structural integrity?

Expression and purification of functional C. merolae PsaL presents significant challenges due to its membrane-embedded nature and role in complex assembly. Based on comparative analysis of membrane protein expression systems, three approaches have shown promise:

Expression SystemAdvantagesLimitationsReported YieldPurification Strategy
E. coli with fusion tags- High expression levels
- Rapid growth
- Cost-effective
- Improper folding
- Inclusion body formation
- Lack of post-translational modifications
2-5 mg/L cultureNi-NTA affinity chromatography followed by size exclusion in detergent micelles
Yeast expression systems- Eukaryotic processing
- Moderate yields
- Proper folding
- Glycosylation patterns differ
- Slower growth than bacteria
0.5-1.5 mg/L cultureFLAG-tag affinity purification with low-temperature extraction
Cell-free expression- Direct incorporation into lipid environments
- Avoids toxicity issues
- Expensive
- Lower yields
- Scalability challenges
0.1-0.5 mg/L reactionDirect insertion into nanodiscs with subsequent affinity purification

For maintaining structural integrity, extraction should occur under conditions that mimic C. merolae's natural thermal environment (40-42°C) using mild detergents like n-dodecyl-β-D-maltoside (DDM) at concentrations just above critical micelle concentration . Considering that PSI complexes in their native state contain numerous cofactors, including chlorophylls and carotenoids, reconstitution strategies should account for proper cofactor incorporation, particularly when studying interaction interfaces and assembly dynamics.

How do heat shock conditions affect expression and stability of recombinant PsaL proteins from C. merolae compared to mesophilic algae?

C. merolae exhibits extraordinary heat tolerance, surviving temperatures up to 63°C, which suggests its photosynthetic proteins possess unique structural adaptations . When expressing recombinant PsaL from C. merolae, the protein demonstrates significantly greater thermostability compared to orthologs from mesophilic species such as Chlamydomonas reinhardtii. This thermostability manifests as maintenance of secondary structure at elevated temperatures and resistance to thermal denaturation.

Experimental thermal stability analyses have revealed that while mesophilic PsaL proteins typically begin unfolding at temperatures above 45°C, the C. merolae PsaL maintains structural integrity up to approximately 60°C. This exceptional stability appears linked to an increased proportion of salt bridges, hydrophobic core packing, and potentially proline residues in loop regions . Of particular interest, the heat shock response in C. merolae is triggered not by relative temperature changes but by absolute temperature thresholds, suggesting the evolution of precise temperature-sensing mechanisms that may extend to structural proteins like PsaL .

When designing recombinant expression protocols, incorporating a heat shock step (50-55°C for 15-20 minutes) during protein extraction can be advantageous, as it selectively precipitates many mesophilic host proteins while leaving the thermostable C. merolae PsaL largely unaffected, effectively serving as an initial purification step.

What structural differences exist between C. merolae PsaL and the corresponding subunits in other photosynthetic organisms that might explain its extremophile adaptations?

Structural analysis of C. merolae PsaL reveals several key adaptations that likely contribute to its function in extreme environments:

  • Transmembrane helices contain a higher proportion of branched hydrophobic amino acids (particularly valine and isoleucine) compared to mesophilic counterparts, creating tighter packing of the protein core.

  • Surface-exposed loops are generally shorter and contain more charged residues forming stabilizing salt bridges, which resist the denaturing effects of high temperatures.

  • The trimerization interface where PsaL mediates PSI monomer interactions shows enhanced hydrophobic contacts and additional hydrogen bonding networks compared to mesophilic systems like those found in Chlamydomonas reinhardtii .

These adaptations are consistent with structural features observed in other extremophile proteins and likely represent evolutionary adaptations to C. merolae's habitat in acidic hot springs. When designing mutations or chimeric proteins incorporating portions of C. merolae PsaL, researchers should pay particular attention to these regions as they may contain transferable elements for enhancing thermostability in other photosynthetic proteins.

What techniques are most effective for analyzing the association of recombinant PsaL with other PSI subunits and pigment molecules?

Investigating the association of recombinant PsaL with other PSI components requires specialized techniques that can preserve native-like interactions while providing high-resolution data. Based on approaches used with similar photosynthetic complexes, the following methodologies have proven most effective:

Single-particle cryo-electron microscopy has emerged as the gold standard for structural analysis, capable of resolving PSI complexes at 3.3 Å resolution or better, as demonstrated with other cyanobacterial PSI structures . This technique allows visualization of protein-protein interfaces and precise mapping of pigment binding sites without the need for crystallization.

For biochemical characterization of subunit interactions, native gel electrophoresis combined with second-dimension SDS-PAGE effectively separates intact complexes before analyzing individual components. When applying this technique to C. merolae PSI, running the first dimension at elevated temperatures (30-35°C) better preserves complex integrity compared to standard conditions.

Pigment-protein interactions can be quantitatively assessed using absorption and fluorescence spectroscopy of reconstituted complexes. C. merolae PSI complexes typically contain chlorophyll a with characteristic absorption peaks at approximately 680 nm . Proper PsaL incorporation and folding often correlates with the correct binding of 2-3 chlorophyll molecules per subunit, which can be verified through pigment extraction and HPLC analysis.

What are the most reliable methods for genetic transformation of C. merolae for in vivo studies of modified psaL genes?

Genetic transformation of C. merolae requires specialized approaches due to its unique cell wall composition and extremophilic nature. The following methodology has demonstrated the highest efficiency for targeted genetic modification:

The polyethylene glycol (PEG)-mediated transformation using uracil auxotrophic selection is currently the most reliable approach for C. merolae. This method typically yields transformation efficiencies of 10⁻⁵ to 10⁻⁶ (transformants per viable cell). For psaL gene modifications, homologous recombination with flanking sequences of at least 1 kb on each side is recommended due to the compact genome structure and overlapping gene arrangements found in C. merolae .

Post-transformation selection should be conducted under elevated temperature (42°C) and acidic conditions (pH 2.5) to maintain selective pressure that ensures only properly transformed cells survive. Verification of successful transformation should include both genomic PCR and functional analysis through spectroscopic measurement of PSI complex formation and integrity.

For researchers specifically interested in psaL modifications, it is critical to monitor photosystem assembly through non-denaturing protein extraction followed by blue native PAGE analysis, as improper PsaL expression or incorporation will typically manifest as altered migration patterns of the PSI complex.

How can researchers accurately quantify the stoichiometry of recombinant PsaL incorporation into PSI complexes?

Determining the precise stoichiometry of recombinant PsaL incorporation presents technical challenges due to the complex nature of multisubunit membrane protein assemblies. The most reliable quantification approach combines multiple complementary techniques:

Isotope dilution mass spectrometry using heavy-labeled peptide standards derived from unique PsaL tryptic fragments provides absolute quantification with accuracy typically within ±5%. This approach requires careful selection of proteotypic peptides that are consistently observed following digestion and are unique to the PsaL sequence.

Fluorescence correlation spectroscopy with fluorescently tagged PsaL variants can provide in-solution measurements of incorporation efficiency. When calibrated against samples of known concentration, this method achieves detection limits down to nanomolar concentrations with the advantage of requiring minimal sample volumes (typically <20 μL).

For routine analysis, densitometric quantification of Coomassie-stained BN-PAGE gels provides a simplified approach, though with lower precision (±15-20%). Researchers should normalize PsaL band intensity against the PsaA/B bands, which maintain consistent stoichiometry across samples and serve as internal standards.

In all cases, proper accounting for the unique spectroscopic properties of C. merolae photosystems is essential, particularly the distinct chlorophyll absorption characteristics that may differ from model photosynthetic organisms .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.