Recombinant Cyanidioschyzon merolae Photosystem II reaction center protein H (psbH)
Description
Overview and Classification
Photosystem II reaction center protein H (psbH) is a small but vital component of the photosynthetic apparatus in oxygenic photosynthetic organisms. In Cyanidioschyzon merolae, psbH is encoded by the psbH gene located in the chloroplast genome . This protein belongs to the broader family of photosystem II (PSII) proteins, which collectively form the complex responsible for the water-splitting reaction in photosynthesis.
As one of the low molecular weight subunits of PSII, psbH serves critical structural and functional roles. It is classified as a reaction center protein, indicating its proximity to the core of PSII where the primary photochemical reactions occur. Despite its small size, research indicates that psbH plays significant roles in PSII assembly, stability, and possibly in regulatory functions related to photosynthetic efficiency .
The psbH protein is also known by synonyms including "Photosystem II reaction center protein H" and "PSII-H," and is identified by the UniProt ID Q85FZ2 in the case of C. merolae . The gene encoding this protein appears to be independently transcribed in photosynthetic organisms, suggesting a level of transcriptional regulation distinct from other photosystem components .
Evolutionary Conservation
C. merolae is a unicellular red alga that has gained significant attention as a model organism for studying organelle division and inheritance . It thrives in low pH environments (approximately 0.2 to 4) and at moderately high temperatures (40–56°C) . These extreme conditions likely influence the structural and functional properties of its photosynthetic proteins, including psbH, potentially conferring unique characteristics that distinguish it from homologs in mesophilic organisms.
The evolutionary significance of psbH is further highlighted by genetic studies showing that while the protein is conserved, its absence can be tolerated under certain conditions, albeit with significant impacts on photosystem II assembly and stability . This suggests that psbH may have evolved to optimize photosynthetic efficiency rather than serving as an absolutely essential component.
Amino Acid Sequence and Structure
The recombinant Cyanidioschyzon merolae Photosystem II reaction center protein H (psbH) consists of 64 amino acids with the following sequence: MALRTRLGEILRPLNSQYGKVAPGWGTTPIMGVFMVLFLLFLVIILQIYNSSLLLNDVQVDWMG . This sequence represents the full-length protein (amino acids 1-64) and contains characteristic hydrophobic regions that facilitate its integration into the thylakoid membrane.
For recombinant expression purposes, the protein is typically fused to an N-terminal histidine tag (His-tag), which facilitates purification through affinity chromatography . This modification does not significantly alter the protein's functional characteristics but provides a convenient handle for isolation from the expression host.
Physiochemical Properties
The recombinant psbH protein exhibits several important physiochemical properties that influence its behavior during expression, purification, and functional studies. As a membrane protein, it possesses hydrophobic regions that affect its solubility and may necessitate the use of detergents or specialized buffers during handling.
Table 1: Key Properties of Recombinant C. merolae psbH Protein
| Property | Description |
|---|---|
| Source | Expressed in E. coli |
| Tag | N-terminal His-tag |
| Protein Length | Full Length (1-64 amino acids) |
| Form | Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE |
| Storage Buffer | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Storage Recommendations | -20°C/-80°C upon receipt, aliquoting necessary for multiple use |
| Stability | Repeated freeze-thaw cycles not recommended; working aliquots stable at 4°C for up to one week |
For storage and handling, the protein is recommended to be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . The addition of glycerol (5-50% final concentration) is advised for long-term storage at -20°C/-80°C, with a default final concentration of 50% glycerol providing optimal stability . Repeated freeze-thaw cycles should be avoided to maintain protein integrity, and working aliquots can be stored at 4°C for up to one week .
Post-translational Modifications
One of the most significant post-translational modifications of psbH is phosphorylation, which appears to occur at multiple sites within the protein . This modification plays important roles in regulating the protein's function and its interactions within the photosystem II complex.
Research indicates that psbH phosphorylation may influence PSII structure, stabilization, or activity . The phosphorylation status of psbH can change in response to varying light conditions or other environmental factors, suggesting a regulatory mechanism that allows photosynthetic organisms to adjust their photosynthetic efficiency under different conditions.
In the context of recombinant protein production, it is important to note that heterologous expression systems such as E. coli may not replicate all the post-translational modifications that occur in the native organism. This limitation should be considered when using recombinant psbH for functional studies, particularly those investigating phosphorylation-dependent activities.
Role in Photosystem II Assembly
The psbH protein plays a critical role in the assembly of photosystem II complexes. Studies have demonstrated that in the absence of PSII-H, the accumulation of high-molecular-weight forms of PSII is severely impaired . This observation suggests that psbH facilitates the formation of properly structured PSII complexes, potentially by promoting interactions between different PSII subunits or by stabilizing intermediate assembly states.
Interestingly, the absence of psbH does not prevent the translation and thylakoid insertion of chloroplast PSII core proteins . This indicates that psbH is not required for the initial stages of PSII protein synthesis and membrane insertion but rather plays a role in subsequent assembly steps that lead to the formation of functional PSII complexes.
Contribution to PSII Stability
Beyond its role in assembly, psbH significantly contributes to the stability of fully formed photosystem II complexes. Research has shown that in the absence of psbH, PSII proteins do not accumulate to normal levels, indicating enhanced degradation or turnover . This effect is observed even in dark-grown cells, suggesting that it is not related to photoinhibition but rather to an intrinsic structural requirement for psbH in maintaining PSII stability .
A primary role of psbH appears to be in facilitating PSII dimerization , a process that contributes to the supramolecular organization of photosynthetic complexes within the thylakoid membrane. PSII dimers are thought to represent the most stable and functional form of the complex, and psbH's contribution to dimerization may therefore be central to its role in maintaining PSII stability and function.
Phosphorylation and Regulatory Functions
The psbH protein is subject to phosphorylation, which likely occurs at two sites . This post-translational modification appears to play important roles in regulating PSII structure, stabilization, or activity , suggesting a dynamic control mechanism that allows photosynthetic organisms to adjust their photosynthetic machinery in response to changing environmental conditions.
The regulatory functions of psbH phosphorylation are likely integrated with other signaling pathways that respond to light intensity, spectral quality, nutrient availability, or other environmental parameters. This integration would enable coordinated adjustments of photosynthetic activity to optimize energy capture while minimizing the risk of photodamage under varying conditions.
Expression Systems
To optimize expression in E. coli, the psbH gene is typically cloned into an expression vector that provides appropriate regulatory elements for controlled protein production. The addition of an N-terminal histidine tag (His-tag) facilitates subsequent purification steps . Selection of suitable E. coli strains, culture conditions, and induction parameters is critical for maximizing protein yield while maintaining proper folding and minimizing aggregation.
C. merolae itself has emerged as a promising host for recombinant protein expression, with recent advances in genetic transformation techniques for both nuclear and chloroplast genomes . These developments suggest the possibility of homologous expression of modified psbH proteins, which could preserve native post-translational modifications and potentially yield more functionally authentic recombinant proteins.
Purification Methods
The purification of recombinant psbH protein typically leverages the His-tag fusion for affinity chromatography . This approach enables selective binding of the tagged protein to nickel or cobalt resins, followed by washing steps to remove contaminants and elution with imidazole or other competitive agents to recover the purified protein.
Given the membrane-associated nature of psbH, purification protocols likely incorporate detergents or other solubilizing agents to maintain protein solubility throughout the process. The selection of appropriate detergents is critical, as they must effectively solubilize the protein while preserving its structural integrity and functional properties.
Following affinity purification, additional chromatographic steps such as size exclusion or ion exchange may be employed to further enhance purity. The final purified protein is typically formulated in a stabilizing buffer and lyophilized for long-term storage . The lyophilized powder provides a stable form that can be reconstituted as needed for experimental use.
The purification process achieves a final product with purity greater than 90% as determined by SDS-PAGE , indicating a high-quality preparation suitable for structural and functional studies. This level of purity is essential for ensuring that experimental results reflect the properties of psbH itself rather than those of contaminating proteins.
Quality Control Parameters
Reconstitution protocols are carefully designed to maintain protein stability and functionality. The recommended approach involves brief centrifugation to bring the contents to the bottom of the vial, followed by reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL . The addition of glycerol (5-50% final concentration) is advised for long-term storage preparations .
Storage recommendations include maintaining the lyophilized powder at -20°C/-80°C upon receipt, with aliquoting necessary for multiple use . Working aliquots can be stored at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided to preserve protein integrity . The storage buffer, consisting of a Tris/PBS-based solution with 6% trehalose at pH 8.0 , provides an environment that minimizes protein denaturation or degradation during storage.
Functional Analysis of Photosynthesis
The recombinant psbH protein enables a range of functional analyses focused on photosynthetic mechanisms. In vitro reconstitution experiments combining purified psbH with other PSII components can help elucidate its contributions to complex assembly, stability, and activity.
Studies examining the interactions between psbH and other PSII proteins can reveal the molecular basis for its effects on complex dimerization and stability. Techniques such as co-immunoprecipitation, cross-linking, or protein-protein interaction assays using recombinant components can map the interaction network within PSII, highlighting psbH's specific partners and binding sites.
The role of psbH phosphorylation in regulating PSII function can be investigated using recombinant protein variants with modified phosphorylation sites. These studies can clarify how this post-translational modification affects psbH's interactions, structural properties, and contributions to photosynthetic electron transport.
Complementation experiments, in which recombinant psbH is introduced into psbH-deficient organisms, can demonstrate the protein's ability to restore normal PSII assembly and function. Such experiments can be particularly informative when using modified psbH variants, allowing the functional consequences of specific alterations to be assessed in vivo.
Biotechnological Applications
Beyond its value for basic research on photosynthesis, recombinant psbH protein may have applications in biotechnology. As efforts to enhance photosynthetic efficiency in crop plants or biofuel-producing algae continue, insights from studies of psbH could inform strategies for engineering improved photosynthetic performance.
The development of synthetic photosystems for artificial photosynthesis or light-harvesting applications could benefit from incorporating design principles derived from understanding psbH's contributions to natural photosystem II. Recombinant psbH could serve as a component in such synthetic systems or provide a template for designing functional analogs.
Antibodies generated against recombinant psbH may serve as tools for monitoring PSII assembly, turnover, or modifications in experimental systems. Such antibodies could facilitate studies of photosynthetic responses to environmental stresses, developmental changes, or genetic modifications.
The recombinant production methods established for psbH provide a template for expressing other photosynthetic proteins from extremophilic organisms like C. merolae. These proteins may possess unique properties related to thermal stability or acid tolerance that could be valuable for biotechnological applications requiring robust photosynthetic components.
Product Specs
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request if possible.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Target Background
KEGG: cme:CymeCp106
STRING: 45157.CMV127CT
Q&A
What is the structural composition of Cyanidioschyzon merolae psbH protein?
The psbH protein from Cyanidioschyzon merolae is a small membrane protein consisting of 64 amino acids with the sequence: MALRTRLGEILRPLNSQYGKVAPGWGTTPIMGVFMVLFLLFLVIILQIYNSSLLLNDVQVDWMG . It functions as a small subunit of the photosystem II complex. The protein is typically expressed with tags (such as His-tag) for purification purposes when produced recombinantly. The molecular structure reveals a transmembrane orientation with specific domains that interact with other PSII components, particularly contributing to the stabilization of CP47 attachment to the D1-D2 heterodimer .
How does psbH contribute to photosystem II stability?
The psbH protein plays a critical role in maintaining PSII stability through multiple mechanisms. Studies with deletion mutants have demonstrated that absence of psbH leads to significant destabilization of the PSII complex. Specifically, in the absence of the psbH gene product, CP47 becomes easily detached during non-denaturing electrophoresis of the PSII core . Additionally, psbH appears to stabilize bicarbonate binding on the PSII acceptor side, as evidenced by the altered QA- reoxidation rates in mutants lacking psbH when CO2 is depleted . The protein's stabilizing function is likely mediated through specific protein-protein interactions within the PSII complex, particularly with the CP47 subunit and possibly through maintaining optimal conformations of the D1-D2 heterodimer.
What are the optimal expression conditions for recombinant psbH protein?
Recombinant expression of psbH has been successfully achieved in E. coli expression systems. The most effective approach involves using fusion protein strategies to overcome the intrinsic challenges of expressing membrane proteins. Specifically, expressing psbH as a fusion with glutathione-S transferase (GST) has proven effective in producing soluble protein . The GST anchor helps overcome the low solubility typical of membrane proteins and reduces potential toxicity caused by protein incorporation into the host organism's membranes. Optimal expression conditions include using E. coli BL21(DE3) cells with controlled induction parameters . After expression, the protein can be purified under non-denaturing conditions using affinity chromatography on immobilized glutathione, followed by fusion tag removal using Factor Xa protease and further purification via DEAE-cellulose column chromatography .
How does the absence of psbH affect D1 protein stability under varying light conditions?
The absence of the psbH protein significantly impacts D1 protein stability, particularly under illumination. Research has shown that in mutants lacking psbH (such as the IC7 strain in Synechocystis), illumination leads to extensive oxidation, fragmentation, and cross-linking of the D1 protein . This destabilization appears to be mediated through altered redox chemistry at the PSII acceptor side. Specifically, the light-induced decrease in PSII activity, measured as 2,5-dimethyl-benzoquinone-supported Hill reaction, shows strong dependence on HCO3- concentration in cells lacking psbH . This suggests that psbH plays a role in maintaining optimal bicarbonate binding, which in turn protects the D1 protein from oxidative damage under illumination. The protective mechanism likely involves proper electron flow through the PSII complex, preventing the formation of reactive oxygen species that would otherwise damage the D1 protein.
What is the evolutionary relationship between psbH in Cyanidioschyzon merolae and other photosynthetic organisms?
Phylogenetic analyses of photosynthetic proteins reveal interesting evolutionary relationships for Cyanidioschyzon merolae components. While not directly addressing psbH, research on small heat shock proteins (sHSPs) in Cyanidioschyzon merolae suggests that proteins from the Cyanidiaceae family (including C. merolae, Cyanidium caldarium, and Galdieria sulphuraria) are more closely related to bacterial genes than to those from other algae or land plants . This evolutionary pattern might extend to other photosynthetic proteins including psbH. The evolutionary conservation of psbH across photosynthetic organisms underscores its fundamental importance in photosynthesis. Comparative analyses between cyanobacterial psbH (such as from Synechocystis) and eukaryotic versions (like C. merolae) can provide insights into the evolutionary adaptations of photosynthetic machinery during endosymbiotic events and subsequent specialization.
How does temperature stress affect psbH expression and function in Cyanidioschyzon merolae?
Cyanidioschyzon merolae inhabits acidic hot springs and demonstrates remarkable temperature tolerance, surviving heat shock treatments up to 63°C . While specific data on psbH expression under temperature stress is not directly provided in the search results, research on heat shock responses in C. merolae shows that certain genes (particularly small heat shock proteins) are dramatically upregulated in response to heat elevation . Given psbH's role in maintaining PSII stability, it is reasonable to hypothesize that its expression or post-translational modifications might be regulated during temperature stress to preserve photosynthetic function. The thermal adaptation mechanisms in C. merolae appear to respond to absolute temperature thresholds rather than relative temperature changes, which represents a unique adaptation to extreme environments . Further research examining psbH expression patterns under varying temperature conditions would provide valuable insights into its role in thermal adaptation of photosynthetic machinery.
What are the optimal protocols for purification of recombinant psbH protein?
The purification of recombinant psbH protein involves several critical steps that have been optimized to yield pure, functional protein suitable for structural and functional studies. The recommended protocol includes:
-
Expression as a GST fusion protein in E. coli BL21(DE3) cells
-
Cell lysis under non-denaturing conditions
-
Affinity purification using glutathione-immobilized resin
-
Cleavage of the fusion protein using Factor Xa protease
-
Ion-exchange chromatography on DEAE-cellulose column
This approach yields approximately 2.1 μg protein/ml of bacterial culture . The purification under non-denaturing conditions is crucial for maintaining protein structure and function. Prior to use, reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL is recommended, with the addition of 5-50% glycerol (final concentration) for long-term storage at -20°C/-80°C .
| Purification Step | Method | Conditions | Expected Yield |
|---|---|---|---|
| Initial Capture | GST affinity chromatography | Non-denaturing | ~60-70% recovery |
| Tag Cleavage | Factor Xa digestion | 16-24h at 4°C | ~80-90% efficiency |
| Secondary Purification | DEAE-cellulose chromatography | pH 8.0 buffer | ~2.1 μg/ml culture |
| Storage | Aliquoting with glycerol | -20°C/-80°C | Stable for months |
How can researchers effectively analyze psbH-mediated PSII stability in mutant systems?
Analyzing psbH-mediated PSII stability requires multiple complementary approaches:
-
Biochemical stability assessment: Non-denaturing electrophoresis of isolated PSII cores can reveal the stability of protein-protein interactions within the complex. In systems lacking psbH, CP47 detachment serves as a key indicator of complex destabilization .
-
Functional assays: Measuring QA- reoxidation rates under varying CO2 conditions provides insights into acceptor-side stability. The 2,5-dimethyl-benzoquinone-supported Hill reaction under different HCO3- concentrations can reveal functional consequences of structural destabilization .
-
D1 protein oxidation analysis: Western blotting combined with oxidation-specific antibodies or mass spectrometry can quantify oxidative modifications to the D1 protein under illumination, providing a measure of PSII vulnerability in the absence of psbH .
-
Mutant construction: Improved transformation methods using diphtheria toxin genes as auxiliary selectable markers have enhanced the selectivity and efficiency of C. merolae transformation . This approach allows for more reliable creation of psbH mutants for comparative studies.
For in vivo analysis, researchers should consider heat shock treatments using precise temperature control methods as described for C. merolae studies: cell cultures placed in glass test tubes and incubated in constant temperature baths for controlled durations (typically 20 minutes) . Photosynthetic pigment quantification (chlorophyll a and phycocyanin) provides additional physiological markers for assessing PSII function .
What biophysical techniques are most informative for characterizing psbH structure and interactions?
Multiple biophysical techniques provide complementary information about psbH structure and interactions:
-
Solid-state NMR spectroscopy: The successful expression and purification of sufficient quantities of psbH makes this technique particularly valuable for structural characterization of this membrane protein . Solid-state NMR can provide atomic-level details of protein structure in a membrane environment.
-
Cross-linking studies combined with mass spectrometry: These approaches can identify specific interaction partners and contact points between psbH and other PSII components, particularly CP47 and elements of the D1-D2 heterodimer .
-
Electron paramagnetic resonance (EPR): This technique can provide insights into the effects of psbH on the electronic structure of cofactors within PSII, particularly those involved in electron transfer pathways.
-
Fourier-transform infrared spectroscopy (FTIR): FTIR can detect subtle changes in protein secondary structure and hydrogen bonding patterns, which may reveal how psbH stabilizes PSII components.
-
Thermal stability assays: Given C. merolae's adaptation to high temperatures, differential scanning calorimetry or fluorimetry could reveal how psbH contributes to PSII thermal stability .
When designing biophysical studies, researchers should consider the membrane environment's importance for maintaining native psbH structure and interactions. Reconstitution into appropriate lipid environments or nanodiscs can provide more physiologically relevant conditions for structural and functional analyses.
How does psbH function contribute to understanding extremophile adaptations in Cyanidioschyzon merolae?
Cyanidioschyzon merolae thrives in extreme environments, particularly acidic hot springs with temperatures approaching 63°C . Understanding psbH's role in this organism provides insights into photosynthetic adaptation to extreme conditions. Research indicates that C. merolae possesses unique temperature-sensing mechanisms that trigger specific gene expression at absolute temperature thresholds rather than relative temperature changes . While direct evidence for psbH involvement in these pathways is not provided in the search results, its critical role in PSII stability suggests it may contribute to thermal adaptation mechanisms.
The structural features of psbH in C. merolae may include adaptations that enhance protein-protein interactions or membrane integration under extreme conditions. Comparative studies between psbH from C. merolae and mesophilic organisms could reveal specific adaptations that contribute to extremophile physiology. Additionally, investigating post-translational modifications of psbH under varying temperature conditions might reveal regulatory mechanisms specific to thermoacidophilic environments.
What are the implications of psbH research for engineering enhanced photosynthetic efficiency?
Research on psbH provides several potential avenues for engineering enhanced photosynthetic efficiency:
Methodologically, the successful recombinant expression and purification systems developed for psbH provide valuable tools for structure-function studies that could inform rational protein engineering approaches. Additionally, the improved transformation methods for C. merolae offer opportunities to test engineered variants in a model system adapted to extreme conditions.
What are the most promising approaches for resolving the high-resolution structure of psbH in its native environment?
While current methods have successfully produced recombinant psbH for biophysical studies , resolving its high-resolution structure within the native PSII complex remains challenging. Several promising approaches include:
-
Cryo-electron microscopy (cryo-EM): Recent advances in cryo-EM technology have enabled atomic-resolution structures of membrane protein complexes. Applying these techniques to PSII complexes from C. merolae could reveal psbH's structure and interactions in near-native conditions.
-
Integrated structural biology: Combining multiple techniques such as solid-state NMR , X-ray crystallography, and computational modeling could provide complementary structural insights.
-
Native mass spectrometry: This emerging technique can analyze intact membrane protein complexes, potentially revealing the stoichiometry and stability of psbH interactions within PSII.
-
In situ structural studies: Techniques such as electron tomography could visualize PSII complexes directly within thylakoid membranes, providing insights into psbH's role in the native cellular context.
The established expression and purification protocols for recombinant psbH provide a foundation for these structural studies, potentially enabling site-directed spin labeling for EPR studies or isotope labeling for NMR analyses.
How might comprehensive transcriptomic and proteomic analyses enhance our understanding of psbH regulation?
Comprehensive -omics approaches could significantly advance our understanding of psbH regulation in C. merolae:
-
Transcriptomic analyses under varying conditions: RNA-seq studies across temperature gradients, light intensities, and nutrient conditions could reveal how psbH expression is coordinated with other photosynthetic genes and stress responses.
-
Proteomics of post-translational modifications: Mass spectrometry-based approaches could identify potential phosphorylation, acetylation, or other modifications of psbH that might regulate its function or interactions.
-
Interactome studies: Techniques such as proximity labeling combined with mass spectrometry could identify the complete set of psbH interaction partners under different environmental conditions.
-
Ribosome profiling: This technique could reveal translational regulation of psbH, which might be particularly important in rapid responses to environmental changes.
These approaches would benefit from the improved transformation methods for C. merolae , enabling the creation of reporter constructs or tagged versions of psbH for in vivo studies. The extreme conditions in which C. merolae thrives provide a unique opportunity to study gene regulation under environmental stress.
