Recombinant Cyanidioschyzon merolae Photosystem Q (B) protein (psbA)

Shipped with Ice Packs
In Stock

Description

Definition and Background

The Recombinant Cyanidioschyzon merolae Photosystem Q(B) protein (psbA) refers to a genetically engineered version of the D1 protein, a core component of Photosystem II (PSII) in this extremophilic red alga. Native to high-temperature environments, C. merolae has evolved unique adaptations in its photosynthetic machinery, with psbA encoding the 32 kDa thylakoid-bound D1 protein. This protein is pivotal for electron transfer during the light-dependent reactions and serves as the binding site for photosynthetic herbicides and the secondary quinone acceptor Q(B) .

Evolutionary Context

OrganismSequence IdentityShared Features
C. caldarium (Red Alga)68.8% PsbQ’ subunit, similar PSII architecture
Ananas comosus (Plant)30% Q(B) binding site, herbicide sensitivity
Cyanobacteria25-30% Core PSII subunit structure, OEC proximity

Role in PSII Function

The D1 protein forms part of the PSII reaction center, facilitating electron transfer from P680 to Q(A) and Q(B). Its deletion or mutation disrupts oxygen evolution, reduces PSII activity by ~50%, and destabilizes interactions with extrinsic subunits like PsbV and PsbU .

Functional Impacts of Mutations

PhenotypeObservation
Oxygen EvolutionReduced activity, impaired OEC stabilization
DimerizationIncreased monomer abundance, lower dimer stability
Antennae AssemblyShorter phycobilisome rods, reduced light-harvesting efficiency
Zeaxanthin Regulation50% reduction in zeaxanthin levels, altered NPQ mechanisms

Recombinant Expression Systems

The recombinant psbA protein is typically expressed in E. coli with a His-tag for affinity purification. Commercial preparations include:

  • Purity: >90% (SDS-PAGE verified)

  • Storage: Tris-based buffer with 50% glycerol at -20°C/-80°C

  • Stability: Avoid repeated freeze-thaw cycles; store working aliquots at 4°C

Research and Biotechnological Uses

  1. PSII Structural Studies:

    • Reconstitution assays to analyze interactions with PsbQ’, PsbV, and cytochrome c550 .

    • Investigation of herbicide-binding mechanisms and resistance .

  2. Evolutionary Analyses:

    • Comparative studies of D1 proteins across red algae, cyanobacteria, and plants .

  3. Functional Assays:

    • ELISA-based quantification of psbA expression levels .

    • Mutagenesis to map critical residues for electron transport and proton pumping .

Adaptation to Extreme Environments

C. merolae’s psbA plays a role in its thermotolerance and photoprotection. Mutant studies reveal:

  • PSII Upregulation: Compensatory increase in PSII abundance (30-50%) to counteract reduced activity .

  • PSI Downregulation: Imbalanced energy distribution between PSII and PSI, reducing ATP synthesis efficiency .

Insights from ΔpsbQ’ Mutants

Deletion of the PsbQ’ subunit (encoded by a separate gene) in C. merolae highlights its regulatory role:

ParameterΔpsbQ’ MutantWild-Type
PSII Activity~50% reductionFull activity
Phycobilisome Length~50% shorter rodsFull-length
Zeaxanthin Levels50% decreaseNormal

These findings underscore psbA’s integration with extrinsic subunits and light-harvesting complexes .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Cyanidioschyzon merolae (strain 10D) (Red alga)
Target Names
psbA
Target Protein Sequence
MTATLQRRASANLWERFCAWITSTENRLYIGWFGVLMIPCLLTATCVFIIAFVAAPPVDI DGIREPVSGSLFYGNNIITGAVVPTSNAIGLHFYPIWEAASVDEWLYNGGPYQLIVLHFL IGVASYMGREWELSYRLGMRPWICVAFSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMLVFQAEHNILMHPFHMAGVAGVFGGALFSAMHGSLVTSSLIRETSENESLNNGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLGAWPVVGIWLTAIGISTMAFNLNGF NFNQSVVDSEGRVINTWADILNRANLGIEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H2O, generating O2 and a proton gradient subsequently used for ATP formation. It comprises a core antenna complex that captures photons and an electron transfer chain that converts photonic excitation into a charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Database Links
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What are the key characteristics of Cyanidioschyzon merolae that make it valuable for photosystem research?

Cyanidioschyzon merolae is a eukaryotic extremophilic red alga that thrives in environments with low pH (approximately 0.2 to 4) and moderately high temperatures (40-56°C) . This organism possesses several advantageous characteristics for research:

  • Simplified cellular structure with a single chloroplast, mitochondrion, and nucleus

  • Complete genome sequences (nuclear, plastid, and mitochondrial)

  • Photosynthetic apparatus representing an evolutionary intermediate between cyanobacteria and higher plants

  • Remarkable stability of photosynthetic complexes under extreme conditions

  • Amenability to genetic transformation of both nuclear and chloroplast genomes

These features make C. merolae an excellent model organism for studying fundamental aspects of photosynthesis and organelle biology, as well as for exploring evolutionary relationships between prokaryotic and eukaryotic phototrophs .

How does the structure of Photosystem II in C. merolae differ from that in cyanobacteria and higher plants?

The PSII complex in C. merolae represents an evolutionary intermediate with distinctive structural features:

  • C. merolae PSII exists as a dimeric complex similar to cyanobacterial PSII

  • The complex is stabilized by four extrinsic lumenal subunits: PsbO, PsbV, PsbU, and PsbQ′

  • Unlike higher plants that have PsbP and PsbQ, C. merolae retains the cyanobacteria-like PsbV and PsbU

  • An additional 20-kDa subunit PsbQ′ is present, which is distantly related to higher plant PsbQ polypeptides

  • Electron microscopy studies have located PsbQ′ in the vicinity of the CP43 protein, close to the membrane plane

  • The binding mode of PsbV differs from cyanobacteria; in red algae, PsbV binds via other extrinsic subunits rather than directly to the PSII core

These structural differences contribute to the remarkable stability of C. merolae PSII across extreme environmental conditions .

What photoprotection mechanisms have been identified in C. merolae Photosystem II?

C. merolae employs several sophisticated photoprotection mechanisms to maintain photosynthetic efficiency under extreme conditions:

  • pH-dependent reaction center-based non-photochemical quenching (RC-based NPQ), which is reversible and provides protection against excess light

  • High zeaxanthin content, which works in conjunction with NPQ to protect against photodamage

  • Robust stability across extreme light, temperature, and pH conditions

  • Modulation of phycobilisome structure and function in response to light intensity and quality

  • Differential sensitivity of photosynthetic components: allophycocyanin content responds mainly to light intensity, while phycocyanin content is sensitive to both light intensity and quality

  • Balanced regulation of thylakoid membrane and phycobilisome proteins, energy levels, and photosynthetic activity in response to environmental changes

These mechanisms allow C. merolae to maintain efficient photosynthesis under conditions that would damage most photosynthetic organisms .

What methods have proven effective for transformation of the C. merolae chloroplast genome?

Two primary methods have been established for reliable transformation of the C. merolae chloroplast genome:

  • PEG-mediated DNA delivery:

    • Considered more efficient based on comparative studies

    • Involves treating cells with polyethylene glycol to facilitate DNA uptake

    • Protocol typically includes a 3-day recovery period without selection followed by addition of chloramphenicol (200 μg/mL)

  • Biolistic bombardment:

    • Alternative approach using high-velocity DNA-coated microparticles

    • Also effective but may have lower transformation efficiency than PEG-mediated delivery

Both methods rely on double homologous recombination for stable integration of transgenes into the chloroplast genome . The transformed cultures require long-term maintenance under selection pressure (typically 3 months) with weekly medium exchanges to establish stable transformant lines . Single colonies can be isolated on solid medium containing chloramphenicol and further propagated for analysis .

How can homologous recombination be optimized for targeted insertion in the C. merolae chloroplast?

Efficient homologous recombination in C. merolae chloroplast can be achieved through several optimization strategies:

  • Homologous flanking sequences: Long flanking sequences (approximately 2-4 kb) identical to the target region significantly enhance recombination efficiency

  • Strategic locus selection: The intergenic region between rpl32 (CMV046C) and psbA (CMV047C) genes has been successfully used for transgene insertion

  • Vector design considerations:

    • Reconstruction of native regulatory elements (e.g., 5′UTR regions, promoters, terminators) to maintain normal expression of flanking genes

    • Use of codon-optimized sequences for transgenes to enhance expression

  • Selection strategy:

    • Initial cultivation without selection pressure (3 days) followed by gradual introduction of the selective agent

    • Step-wise increases in antibiotic concentration (e.g., chloramphenicol from 150 to 400 μg/mL) to select for transformants with higher expression levels

Proper implementation of these strategies can yield stable transformant lines capable of maintaining transgene expression over extended periods .

What selection markers and reporter systems are most effective for C. merolae chloroplast transformation?

The chloramphenicol acetyltransferase (CAT) gene has emerged as the most reliable selection marker for C. merolae chloroplast transformation:

  • CAT selection system:

    • Chloroplasts are particularly vulnerable to chloramphenicol's lethal effects

    • Codon-optimized CAT sequences enhance expression and selection efficiency

    • Transformants can resist chloramphenicol concentrations up to 400 μg/mL

    • CAT protein can be readily detected using western blot with anti-CAT antibodies

  • Reporter systems:

    • CAT itself serves as both selection marker and reporter gene

    • Protein expression can be monitored using:

      • Western blot analysis with specific antibodies

      • Indirect immunofluorescence to visualize protein localization

      • Enzyme activity assays to confirm functional expression

  • Verification methods:

    • PCR analysis using primers flanking the integration site

    • Southern blot analysis to confirm single-copy integration

    • Absence of vector backbone sequences to verify complete integration via homologous recombination

This selection system has proven robust for generating stable chloroplast transformants of C. merolae .

Which chloroplast promoters have been validated for exogenous protein expression in C. merolae?

Three chloroplast promoters have been specifically validated for exogenous protein expression in C. merolae:

  • PpsbD (Photosystem II D2 protein promoter, gene psbD [CMV081C]):

    • Light-dependent expression profile

    • Responsive to changes in irradiance levels

    • Useful for applications requiring light-modulated expression

  • PrbcL (RuBisCO large chain promoter, gene rbcL [CMV013C]):

    • Cell cycle-dependent expression

    • Linked to carbon fixation activity

    • Suitable for applications requiring coordination with growth phases

  • PdnaK (Hsp70-type chaperone promoter, gene dnaK [CMV163C]):

    • Constitutive expression profile

    • Stable expression regardless of light exposure or cell cycle

    • Ideal for applications requiring continuous, high-level expression

These promoters provide researchers with options for tailoring expression patterns based on experimental requirements . The successful application of these promoters has been confirmed through stable expression of the chloramphenicol acetyltransferase (CAT) gene, with protein detection by western blotting and immunofluorescence .

How do expression dynamics differ among the validated C. merolae chloroplast promoters?

The three validated chloroplast promoters exhibit distinct expression dynamics that can be strategically utilized:

PpsbD (light-dependent promoter):

  • Expression levels increase in response to light exposure

  • Shows diurnal expression pattern under light/dark cycles

  • Western blot analysis reveals higher CAT protein levels during light periods compared to dark periods

  • Useful for experiments requiring light-controlled protein expression

PrbcL (cell cycle-dependent promoter):

  • Expression correlates with cell division and carbon fixation activity

  • Shows differential expression pattern during synchronized growth

  • Western blot analysis demonstrates varying CAT protein levels between light and dark periods

  • Advantageous for studies requiring coordination with specific growth phases

PdnaK (constitutive promoter):

  • Maintains relatively stable expression regardless of environmental conditions

  • Shows consistent CAT protein levels in both light and dark periods

  • Minimal fluctuation across different growth phases

  • Preferred choice for stable, continuous expression of target proteins

Comparative growth curves of transformant strains using these different promoters reveal distinct growth patterns, likely reflecting the metabolic burden associated with different expression dynamics . These differences allow researchers to select the most appropriate promoter based on specific experimental objectives.

What factors should be considered when optimizing promoter-driven expression in the C. merolae chloroplast?

Optimizing promoter-driven expression in C. merolae chloroplast requires consideration of several key factors:

Experimental considerations:

  • Growth conditions: Light intensity, light quality, temperature, and pH significantly affect promoter activity, particularly for light-responsive promoters like PpsbD

  • Cell synchronization: For cell cycle-dependent promoters like PrbcL, synchronized cultures using light/dark cycles (e.g., 8:16 h light:dark regime) can maximize expression at specific time points

  • Expression timing: Harvest timing is critical - cells should be collected at the appropriate phase for maximum expression (e.g., after 1h of light for light-dependent promoters)

Molecular design factors:

  • 5' UTR optimization: The untranslated region preceding the start codon significantly influences translation efficiency

  • Codon optimization: Adapting the coding sequence to C. merolae chloroplast codon usage can enhance expression levels

  • Integration site selection: The position of integration in the chloroplast genome may affect expression levels due to context effects

  • Terminator selection: Appropriate transcription terminators help ensure proper mRNA processing and stability

Quantitative assessment:

  • Protein quantification: Western blot analysis using equal cell numbers (e.g., 0.5 × 10^8 cells) allows direct comparison of expression levels

  • Control proteins: Including nuclear-promoted expression controls and loading controls (e.g., psbA, CBB stained gel) enables accurate normalization

  • Growth impact assessment: Monitoring growth curves helps identify potential metabolic burden from high expression levels

By systematically addressing these factors, researchers can achieve optimal expression levels for their target proteins in the C. merolae chloroplast system.

What are the optimal conditions for cultivating C. merolae for experimental purposes?

Optimal cultivation of C. merolae requires careful control of several environmental parameters:

Standard growth conditions:

  • Temperature: 40-42°C (optimal range), can tolerate up to 56°C

  • pH: 1.5-2.5 (optimal range), can survive pH 0.2-4.0

  • Medium: MA2 medium is commonly used for laboratory cultivation

  • Light conditions:

    • Light intensity: 50-100 μmol photon m^-2 s^-1 for routine maintenance

    • Higher intensities (up to 250 μmol photon m^-2 s^-1) for accelerated growth

    • Light quality significantly impacts growth rates: white light generally supports fastest growth, followed by red, blue, and yellow light

Experimental cultivation systems:

  • Flask cultures: Standard Erlenmeyer flasks with appropriate aeration

  • Multicultivator systems: Allow precise control of light intensity, quality, and continuous monitoring of optical density

  • Air supply: Continuous flow of sterile air (0.5 L min^-1) enhances growth

  • Solid medium: MA2 with 0.4% gellan gum for single-colony isolation

Synchronization protocol:

  • 8:16 h light:dark regime effectively synchronizes cell division

  • Cells can be harvested after specific light/dark transitions for consistent physiological states

For experimental analysis, growth rates should be calculated during the linear growth phase, with measurements taken at multiple time points to ensure reproducibility . These controlled cultivation conditions ensure consistent experimental results and optimal expression of recombinant proteins.

How can the integration and expression of transgenes be verified in transformed C. merolae?

Comprehensive verification of transgene integration and expression involves multiple complementary approaches:

Genomic integration verification:

  • PCR analysis:

    • Design primers that span the junction between the chloroplast genome and the inserted transgene

    • Include additional primers to verify the absence of vector backbone sequences

    • Control PCR reactions targeting endogenous genes confirm DNA quality

  • Southern blot analysis:

    • Restriction digest of total genomic DNA with appropriate enzymes (e.g., PstI)

    • Hybridization with labeled probes specific to the transgene (e.g., cat gene)

    • Confirms single integration events and rules out random integration

Expression analysis:

  • Western blot:

    • Harvest equal cell numbers (0.5 × 10^8) under standardized conditions

    • Separate proteins using SDS-PAGE (15% gels recommended)

    • Transfer to PVDF membrane and probe with specific antibodies

    • Include control proteins (e.g., psbA) for normalization

  • Immunofluorescence microscopy:

    • Fix and permeabilize cells according to established protocols

    • Use primary antibodies specific to the recombinant protein (e.g., 1:100 dilution of anti-CAT antiserum)

    • Detect with fluorescently labeled secondary antibodies (e.g., 1:100 Alexa-488 goat anti-rabbit)

    • Visualize using appropriate filter sets (e.g., DAPI filter set for Alexa-488)

  • Functional assays:

    • For selectable markers like CAT, resistance to increasing antibiotic concentrations confirms functional expression

    • Growth comparison between wild-type and transformant strains under selective conditions

These comprehensive verification methods ensure that the transgene has been properly integrated into the chloroplast genome and is expressing the desired protein at detectable levels.

What methods are available for isolating and characterizing photosystem complexes from C. merolae?

Isolation and characterization of photosystem complexes from C. merolae requires specialized techniques to maintain their structural integrity:

Isolation procedures:

  • Cell disruption:

    • Optimize disruption methods to maintain intact photosystem complexes

    • French press or gentle detergent solubilization are commonly employed

  • Membrane solubilization:

    • Mild detergents (e.g., dodecyl maltoside) preserve native complex structure

    • Critical to maintain the dimeric state of PSII complexes

  • Purification:

    • Sucrose gradient ultracentrifugation for initial fractionation

    • Ion exchange chromatography for further purification

    • Size exclusion chromatography for final polishing and buffer exchange

Structural characterization:

  • Electron microscopy:

    • Negative staining for initial structural assessment

    • Single particle analysis to generate structural maps

    • A 17 Å resolution map has been achieved for the C. merolae PSII dimer

  • Mass spectrometry:

    • Identification of protein subunits and post-translational modifications

    • Comparison with known photosystem components from other organisms

Functional characterization:

  • Oxygen evolution measurements:

    • Quantifies water-splitting activity of isolated PSII complexes

    • Confirms functional integrity after purification

  • Fluorescence analysis:

    • Measures fluorescence quenching properties

    • Assesses pH-dependent non-photochemical quenching mechanisms

    • Provides insights into photoprotection strategies

  • Pigment analysis:

    • HPLC quantification of chlorophyll and carotenoid content

    • Particular attention to zeaxanthin levels, which contribute to photoprotection

These methods have successfully yielded highly active and robust dimeric PSII complexes from C. merolae, enabling detailed structural and functional studies of this unique photosynthetic system that represents an evolutionary intermediate between cyanobacteria and higher plants .

How can C. merolae be utilized for structure-function studies of photosystem evolution?

C. merolae offers unique opportunities for investigating the evolutionary trajectory of photosynthetic complexes:

Evolutionary position advantages:

  • C. merolae photosystems represent intermediate structures between cyanobacteria and higher plants

  • Photosystem I (PSI) exhibits chimeric properties, combining features from both cyanobacteria and plants

  • The 4 Å resolution structure of PSI reveals a core complex with a crescent-shaped antenna structure

Research approaches:

  • Comparative structural biology:

    • Parallel analysis of photosystem complexes from cyanobacteria, C. merolae, and higher plants

    • Identification of conserved and divergent structural elements

    • Mapping the evolutionary acquisition or loss of specific subunits

  • Site-directed mutagenesis:

    • Target specific residues in photosystem proteins to mimic ancestral or advanced states

    • Assess functional impacts to understand evolutionary constraints

    • The established chloroplast transformation system enables precise genetic modifications

  • Hybrid complex reconstitution:

    • In vitro reconstitution experiments with subunits from different evolutionary sources

    • Previous work has shown that C. merolae PsbQ′ can functionally replace spinach PsbQ despite low sequence homology

Research questions addressable:

  • How did the oxygen-evolving complex evolve from primordial photosystems?

  • What structural adaptations enabled photosystems to function in different cellular compartments?

  • How do evolutionary intermediates like C. merolae maintain efficient photosynthesis in extreme environments?

These approaches leverage C. merolae's position as an evolutionary link to provide insights into the stepwise development of modern photosynthetic machinery .

What strategies can optimize recombinant protein production in the C. merolae chloroplast system?

Optimizing recombinant protein production in C. merolae chloroplasts involves multiple integrated strategies:

Expression system optimization:

  • Promoter selection:

    • Match promoter characteristics to expression goals (constitutive vs. inducible)

    • PdnaK promoter for stable, continuous expression regardless of conditions

    • PpsbD promoter for light-regulated expression

    • PrbcL promoter for cell cycle-coordinated expression

  • Translation enhancement:

    • Optimize 5' and 3' untranslated regions to improve mRNA stability and translation efficiency

    • Employ codon optimization based on C. merolae chloroplast codon usage patterns

    • Consider incorporating species-specific translation enhancing elements

Cultivation optimization:

  • Environmental parameters:

    • Adjust light quality and intensity based on promoter choice and protein characteristics

    • Fine-tune temperature within the optimal range (40-42°C) to balance growth rate and protein folding

    • Monitor and maintain pH (1.5-2.5) for optimal growth and protein stability

  • Scale-up considerations:

    • Develop bioreactor systems with precise control of environmental parameters

    • Implement continuous or fed-batch cultivation strategies to maximize biomass and protein yields

    • Optimize harvesting timing based on expression dynamics of the chosen promoter

Protein stabilization strategies:

  • Leverage C. merolae's natural adaptations to extreme conditions for producing thermostable proteins

  • Co-express chaperones or other folding assistants if needed

  • Explore targeting to different chloroplast compartments (stroma vs. thylakoid membrane) based on protein characteristics

Downstream processing:

  • Develop efficient extraction protocols considering C. merolae's unique cell wall characteristics

  • Implement purification strategies compatible with acidic extraction conditions

  • Assess protein functionality under the intended application conditions

By systematically addressing these factors, researchers can harness C. merolae's unique characteristics for efficient production of recombinant proteins that may benefit from the extremophilic nature of this host organism .

How might the unique photoprotection mechanisms in C. merolae be applied to engineering stress-resistant photosynthesis?

The exceptional photoprotection mechanisms of C. merolae provide valuable insights for engineering stress-resistant photosynthesis:

Key photoprotective features with engineering potential:

  • pH-dependent reaction center-based non-photochemical quenching (RC-NPQ)

  • High zeaxanthin content working synergistically with NPQ mechanisms

  • Robust stability of photosystem complexes under extreme conditions

  • Adaptive balancing of photosynthetic components in response to light quality and intensity

Engineering approaches:

  • Genetic transfer of protective mechanisms:

    • Identify and isolate genes responsible for C. merolae's unique RC-NPQ mechanism

    • Transfer these genetic elements to crop plants or biofuel-producing algae

    • Comprehensive characterization of the transferred mechanisms in new hosts

  • Structural engineering of photosystems:

    • Modify binding interfaces between PSII core and extrinsic proteins based on C. merolae model

    • Engineer the position and interaction of PsbQ′ to enhance OEC stability under stress conditions

    • Introduce structural elements that confer pH and temperature stability

  • Pigment profile optimization:

    • Enhance zeaxanthin accumulation in target organisms

    • Modify carotenoid biosynthesis pathways to mimic C. merolae's photoprotective pigment composition

    • Engineer regulatory mechanisms for stress-induced pigment conversion

Potential applications:

  • Crop plants with enhanced photosynthetic efficiency under heat or drought stress

  • Biofuel-producing algae capable of maintaining productivity in fluctuating or extreme environments

  • Photosynthetic biosensors with improved stability for long-term environmental monitoring

Research gaps and challenges:

  • Complete molecular characterization of C. merolae's RC-NPQ mechanism

  • Identification of specific amino acid residues responsible for PSII thermostability

  • Development of efficient transformation systems for transferring multiple genes simultaneously

These approaches could significantly advance efforts to engineer photosynthetic organisms with enhanced stress tolerance, potentially improving agricultural productivity under changing climate conditions and expanding the environmental range for algal biotechnology applications .

What are common challenges in C. merolae chloroplast transformation and how can they be addressed?

Researchers working with C. merolae chloroplast transformation frequently encounter several challenges:

Challenge 1: Low initial transformation efficiency

  • Possible causes:

    • Insufficient homologous sequence length

    • DNA quality or conformation issues

    • Cell wall barrier to DNA entry

  • Solutions:

    • Increase homologous flanking sequences to 2-4 kb for efficient recombination

    • Use freshly prepared, high-quality supercoiled plasmid DNA

    • Optimize PEG concentration and treatment duration for more efficient DNA delivery

    • Consider biolistic delivery with optimized microparticle size and acceleration parameters as an alternative

Challenge 2: False positives during initial selection

  • Possible causes:

    • Spontaneous chloramphenicol resistance

    • Inefficient selection pressure

    • Temporary maintenance of plasmid without integration

  • Solutions:

    • Implement step-wise increases in chloramphenicol concentration (e.g., 150 → 200 → 400 μg/mL)

    • Maintain long-term selection (3+ months) with regular medium exchanges

    • Verify integration by PCR analysis of regions beyond the introduced homologous flanks

    • Confirm absence of vector backbone sequences to rule out whole plasmid integration

Challenge 3: Low or unstable transgene expression

  • Possible causes:

    • Position effects from integration site

    • Suboptimal promoter selection

    • mRNA instability or inefficient translation

  • Solutions:

    • Select promoters appropriate for the desired expression pattern (constitutive vs. regulated)

    • Optimize codon usage for chloroplast expression

    • Include appropriate 5' and 3' UTR elements for mRNA stabilization

    • Consider competition with endogenous gene expression for transcription/translation machinery

Challenge 4: Difficulty obtaining homoplasmic transformants

  • Possible causes:

    • Multiple chloroplast genome copies

    • Selective disadvantage of transgene

  • Solutions:

    • Extend selection period through multiple rounds of single-colony isolation

    • Increase selection pressure gradually to favor genome homogenization

    • Verify homoplasmy by quantitative PCR analysis comparing wild-type to recombinant genome copies

Challenge 5: Phenotypic effects of transformation

  • Possible causes:

    • Metabolic burden from transgene expression

    • Disruption of chloroplast genome organization

    • Interference with normal photosynthetic function

  • Solutions:

    • Monitor growth curves to assess impact on cell proliferation

    • Compare pigment content and photosynthetic parameters with wild-type cells

    • Consider using inducible promoters to minimize long-term metabolic burden

Addressing these challenges through systematic optimization can significantly improve the success rate of C. merolae chloroplast transformation experiments.

How can researchers optimize experimental conditions to study stress responses in recombinant C. merolae strains?

Investigating stress responses in recombinant C. merolae strains requires carefully designed experimental approaches:

Experimental design considerations:

  • Control selection:

    • Include both wild-type and empty vector controls

    • Consider additional controls with non-functional mutant versions of the recombinant protein

    • Maintain identical cultivation histories for all strains to minimize adaptation effects

  • Pre-experimental acclimation:

    • Standardize pre-culture conditions (light, temperature, pH)

    • Consider pre-acclimation to mild stress to assess adaptive responses

    • Ensure consistent physiological state through synchronized cultures

Stress application protocols:

  • Light stress:

    • Apply precise light intensities using calibrated LED systems

    • Consider both intensity (25-250 μmol photon m^-2 s^-1) and spectral quality (white, blue, red, or yellow)

    • Include proper dark recovery periods to assess repair mechanisms

  • Temperature stress:

    • Apply controlled temperature shifts within survivable range (30-56°C)

    • Monitor temperature directly in the culture medium

    • Consider both acute and chronic temperature stress protocols

  • pH stress:

    • Test responses across C. merolae's tolerance range (pH 0.2-4.0)

    • Ensure consistent buffering capacity across test conditions

    • Monitor pH throughout the experiment as cell growth may alter medium pH

Analytical methods:

These approaches enable comprehensive characterization of stress responses in recombinant C. merolae strains, facilitating the development of more robust photosynthetic systems for biotechnological applications.

What analytical techniques provide the most informative data when comparing wild-type and recombinant C. merolae strains?

Comprehensive comparison of wild-type and recombinant C. merolae strains requires multiple complementary analytical approaches:

Growth and morphological analysis:

  • Growth kinetics:

    • Measure optical density at both 680 nm (chlorophyll) and 720 nm (cell density)

    • Calculate growth rates during the linear growth phase under standardized conditions

    • Compare growth curves under different light qualities and intensities (25-250 μmol photon m^-2 s^-1)

  • Microscopic analysis:

    • Bright-field microscopy for cell morphology and size

    • Fluorescence microscopy for cellular localization of recombinant proteins

    • Transmission electron microscopy for ultrastructural analysis of chloroplasts

Molecular and biochemical techniques:

  • Protein analysis:

    • Western blotting with equal cell numbers (0.5 × 10^8) for direct comparison

    • Quantify both recombinant protein and key endogenous proteins (e.g., PsaA, D1, phycobiliproteins)

    • Consider using standard proteins purified from cloned genes for absolute quantification

  • Genomic verification:

    • PCR analysis of integration sites and transgene presence

    • Southern blotting to confirm copy number and integration position

    • Whole genome sequencing to identify any unexpected genomic changes

Physiological and biophysical measurements:

  • Photosynthetic parameters:

    • Oxygen evolution measurements under standardized light conditions

    • Chlorophyll fluorescence analysis (Fv/Fm, NPQ, electron transport rate)

    • P700 absorbance changes to assess PSI activity

  • Pigment analysis:

    • Quantitative determination of chlorophyll content

    • Phycobiliprotein content (phycocyanin, allophycocyanin)

    • Carotenoid profiling with attention to photoprotective pigments (zeaxanthin)

  • Metabolic analysis:

    • ATP/ADP ratio determination to assess energetic status

    • Respiratory activity measurements

    • Carbon fixation rates under various conditions

Stress response assessment:

  • Environmental tolerance:

    • Temperature sensitivity (growth and photosynthesis at 30-56°C)

    • pH tolerance (pH 0.2-4.0)

    • Light stress responses (photoinhibition and recovery kinetics)

  • Molecular stress markers:

    • Expression of heat shock proteins and other stress response genes

    • Oxidative damage indicators (lipid peroxidation, protein carbonylation)

    • Antioxidant enzyme activities

This multi-parameter analytical approach provides comprehensive characterization of recombinant strains, helping to identify both intended modifications and potential unintended consequences of genetic manipulation in C. merolae.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.