Recombinant Cyanothece sp. Apocytochrome f (petA)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary by purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its use.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its use.
Synonyms
petA; PCC8801_0754; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
45-328
Protein Length
Full Length of Mature Protein
Species
Cyanothece sp. (strain PCC 8801) (Synechococcus sp. (strain PCC 8801 / RF-1))
Target Names
petA
Target Protein Sequence
YPFWAQQTAPETPREATGRIVCANCHLAQKPAEVEIPQSVLPDTVFEAVVKIPYDLDSQQ
VLGDGSKGGLNVGAVLMLPEGFKIAPEDRIPEEMKEKIEGLYFQPYREDQENVVIVGPLP
GDQYQEIVFPVLSPDPATNKSIEFGKYSVHLGANRGRGQVYPTGELSNNNAFKASKAGTV
TEISQTEEGGYSVTVTTSEGDVVETIPPGPELIVTKGQQVAAGDALTNNPNVGGFGQKDT
EVVLQSPGRIKGLMVFLAGIMLAQILLVIKKKQVERVQAAEMNF
Uniprot No.
Target Background
Function
A component of the cytochrome b6-f complex, mediating electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Database Links
KEGG: cyp:PCC8801_0754
STRING: 41431.PCC8801_0754
Protein Families
Cytochrome f family
Subcellular Location
Cellular thylakoid membrane; Single-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
