Recombinant Cyanothece sp. ATP synthase subunit a 1 (atpB1)

Shipped with Ice Packs
In Stock

Description

Definition and Genetic Background

AtpB1 (gene: cce_1508 or atpB1) is one of two paralogous subunits (AtpB1 and AtpB2) of the F₀ sector in Cyanothece sp. It facilitates proton translocation across the thylakoid membrane, enabling ATP synthesis . The recombinant form is produced in heterologous expression systems (e.g., E. coli, yeast) for biochemical and structural studies .

Key Gene Features:

FeatureDetail
Gene Namecce_1508 (Cyanothece sp. ATCC 51142)
Alternative NamesatpB1, atpI1
Protein ProductATP synthase F₀ sector subunit a 1
OrthologsFound in Synechococcus, Chlorobaculum, and other cyanobacteria

Expression and Purification

Recombinant AtpB1 is produced using versatile expression systems, as detailed below :

Production Systems and Purity:

Host SystemPurity (SDS-PAGE)Applications
E. coli≥85%Structural studies, antibody production
Yeast≥85%Functional assays, interaction studies
Baculovirus≥85%High-throughput screening
Mammalian Cells≥85%Post-translational modification analysis

Comparative Genomics

Cyanothece sp. ATP synthase genes are organized into two clusters (atp1 and atp2), unlike the single operon in E. coli . AtpB1 resides in the atp2 cluster (atpB-atpE), which is conserved across cyanobacteria and chloroplasts .

Gene Cluster Comparison:

OrganismGene ClusterSubunits Encoded
Cyanothece sp.atp2AtpB1, AtpE
E. coliSingle operonAtpA, AtpB, AtpC, etc.
ChloroplastsatpB-atpEHomologs of cyanobacterial atp2

Functional Studies and Applications

  • Proton Translocation: AtpB1’s transmembrane helices are essential for maintaining proton gradients. Deletion mutants show impaired ATP synthesis under light/dark cycles .

  • Biotechnological Use: Recombinant AtpB1 enables studies on ATP synthase regulation, such as interactions with inhibitors like AtpΘ, a cyanobacterial ATPase activity suppressor .

  • Protein Complex Analysis: Size-exclusion chromatography and mass spectrometry confirm AtpB1’s integration into functional F₀F₁ complexes in Cyanothece sp. .

Research Challenges and Future Directions

  • Structural Resolution: Despite successful recombinant production, high-resolution structures of cyanobacterial AtpB1 remain limited compared to mitochondrial homologs .

  • Regulatory Mechanisms: Further work is needed to clarify how AtpB1 interacts with redox-sensitive subunits (e.g., γ subunit’s β-hairpin) to optimize ATP synthesis under fluctuating light conditions .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please specify it when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for the specific delivery timeline.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing it according to your specification.
Synonyms
atpB1; atpI1; cce_1508; ATP synthase subunit a 1; ATP synthase F0 sector subunit a 1; F-ATPase subunit 6 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Cyanothece sp. (strain ATCC 51142)
Target Names
atpB1
Target Protein Sequence
MDITPDSIIYWQWQWINLNATIVFSWLVMLILVLGSWLITRNLSIEPPLSRWQVALEIIV EQIRQQIRDASQQKADQFLPFIGTLFLFITMANLLTIFPVYQSPAGSLSTTAALALCVFV AVPIYGIKNVGITNYLRHYIQPTPVMLPFNLISEISRTVSLAIRLFGNIMSTSLLVAILI SIVPLFFPAVMTLFGLLVGVIQAYVFTILAMVYIASGMNLQQRKTGNHHA
Uniprot No.

Target Background

Function
Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the function of ATP synthase subunit a in cyanobacteria?

ATP synthase subunit a (encoded by atpB1 in Cyanothece sp.) is an integral membrane component of the F₀ portion of F₀F₁ ATP synthase. This subunit forms part of the proton channel and is critical for proton translocation across the membrane. In cyanobacteria, this subunit enables the enzyme to utilize the proton gradient generated by both photosynthetic and respiratory electron transport chains to drive ATP synthesis. Unlike in plants where ATP synthase operates primarily during photosynthesis, cyanobacterial ATP synthase must function during both light and dark periods, as both photosynthetic and respiratory electron chains generate proton gradients at the thylakoid membranes .

How does the structure of ATP synthase in Cyanothece differ from other photosynthetic organisms?

The F₀F₁ ATP synthase in Cyanothece shares structural similarities with other cyanobacteria but differs significantly from chloroplast ATP synthase despite their evolutionary relationship. While the chloroplast γ subunit contains a nine-amino-acid insertion (–EICDINGXC–) with two cysteine residues that form a redox-sensitive disulfide bond, cyanobacterial ATP synthases lack this insertion . This structural difference reflects the distinct regulatory needs of cyanobacteria, which cannot completely shut down ATP synthase during dark periods as chloroplasts do. Instead, cyanobacterial ATP synthase employs alternative regulatory mechanisms involving the γ subunit, ε subunit, and the small protein AtpΘ .

What genomic features characterize ATP synthase genes in Cyanothece sp.?

Cyanothece sp. ATCC 51142 possesses a complex genome consisting of a 4.9-Mb circular chromosome, a 0.423-Mb linear chromosome, and four plasmids, encoding approximately 5,269 predicted genes . While the genome contains a contiguous set of 34 nitrogen fixation genes, the ATP synthase genes are distributed throughout the genome. The atpB1 gene encoding subunit a is part of the ATP synthase operon. The genome's complexity allows for sophisticated regulation of energy metabolism, which is particularly important for an organism that must balance photosynthesis and nitrogen fixation .

How do regulatory mechanisms of ATP synthase in Cyanothece compare to those in other cyanobacteria?

Cyanothece sp., like other cyanobacteria, employs multiple regulatory mechanisms to control ATP synthase activity, which differs substantially from the redox regulation seen in chloroplasts. While the chloroplast ATP synthase is regulated by a redox-sensitive disulfide bridge in the γ subunit that blocks rotation during darkness, cyanobacterial ATP synthase regulation involves:

  • ADP-mediated inhibition via the γ subunit

  • ε subunit-mediated inhibition, which is ATP-independent in cyanobacteria

  • Regulation by small proteins such as AtpΘ, which interacts directly with ATP synthase subunits to prevent wasteful ATP hydrolysis

These mechanisms allow for nuanced control of ATP synthase activity during fluctuating light conditions and metabolic states, particularly important in Cyanothece where nitrogen fixation creates additional energetic demands .

What is the role of the β-hairpin structure in the γ subunit of cyanobacterial ATP synthase?

The γ subunit of F₀F₁ ATP synthase in photosynthetic organisms contains a characteristic β-hairpin structure formed from an insertion sequence conserved only in phototrophs. This structure plays a critical role in:

  • Regulating ATP hydrolysis activity

  • Controlling intracellular ATP levels in response to changes in light environment

  • Contributing significantly to ATP synthesis efficiency

Biochemical investigations using proteoliposomes containing the entire F₀F₁ ATP synthase from Synechocystis sp. PCC 6803 demonstrated that this structure critically contributes to ATP synthesis while suppressing ATP hydrolysis . Given the evolutionary relationship between cyanobacteria, it is likely that the β-hairpin structure in Cyanothece sp. serves similar functions, though species-specific variations may exist to accommodate the unique metabolic requirements of diazotrophic cyanobacteria .

How does ATP synthase activity coordinate with nitrogen fixation cycles in Cyanothece sp.?

In Cyanothece sp. ATCC 51142, approximately 10% of genes in the genome demonstrate circadian behavior under free-running (continuous light) conditions, with nitrogen fixation genes showing particularly strong circadian regulation . ATP synthase activity must be precisely coordinated with nitrogen fixation cycles because:

  • Nitrogen fixation requires substantial ATP input

  • The nitrogenase enzyme is oxygen-sensitive, necessitating temporal separation from oxygen-evolving photosynthesis

  • Energy production must be maintained even during periods of reduced photosynthetic activity

During nitrogen fixation periods, glycogen degradation, respiratory electron transport, and cyclic photophosphorylation pathways are upregulated to provide ATP while minimizing oxygen production. Many soluble electron carriers (e.g., ferredoxins) and redox carriers (e.g., thioredoxin and glutathione) are strongly induced during nitrogen fixation under continuous light, suggesting their role in enhancing cyclic electron transport for energy production while maintaining appropriate redox levels .

What are the best methods for expressing and purifying recombinant Cyanothece sp. ATP synthase subunit a 1?

MethodAdvantagesLimitationsSpecial Considerations
E. coli expression systemHigh yield, well-established protocolsMembrane protein folding challengesRequires fusion tags (His6, GST) to enhance solubility
Cell-free expressionAvoids toxicity issues, allows direct incorporation into liposomesLower yield, higher costOptimal for functional studies requiring membrane environment
Native purification from CyanotheceMaintains natural post-translational modificationsLower yield, technically challengingRequires careful membrane solubilization with mild detergents

For successful expression and purification of recombinant Cyanothece sp. ATP synthase subunit a 1, researchers should consider the following methodological approach:

  • Clone the atpB1 gene into an expression vector with an inducible promoter

  • Express in C41(DE3) or C43(DE3) E. coli strains specifically developed for membrane protein expression

  • Solubilize membranes using mild detergents such as n-dodecyl-β-D-maltoside (DDM)

  • Purify using affinity chromatography followed by size exclusion chromatography

  • Validate proper folding through circular dichroism spectroscopy

This approach is similar to methods successfully employed for other cyanobacterial membrane proteins, including ATP synthase components from Synechocystis sp. PCC 6803 .

How can researchers measure ATP synthase activity in Cyanothece sp. under different physiological conditions?

Measuring ATP synthase activity in Cyanothece sp. requires techniques that can distinguish between synthesis and hydrolysis activities while accounting for the unique day-night metabolic shifts in this organism. Based on successful approaches with other cyanobacteria, a comprehensive assessment should include:

  • Preparation of membrane vesicles or proteoliposomes containing ATP synthase

    • Isolate thylakoid membranes through differential centrifugation

    • For reconstituted systems, purify ATP synthase complex and incorporate into liposomes

  • ATP synthesis activity measurement

    • Generate artificial proton gradient using acid-base transition or light-driven proton pumps

    • Measure ATP production using luciferase assay or HPLC

  • ATP hydrolysis activity assessment

    • Monitor inorganic phosphate release using colorimetric assays

    • Measure using coupled enzyme assays (e.g., pyruvate kinase/lactate dehydrogenase)

  • Proton-translocation assays

    • Use pH-sensitive fluorescent dyes (ACMA or pyranine) to monitor proton movement

    • Correlate proton translocation with ATP synthesis/hydrolysis rates

  • Real-time monitoring under varying light conditions

    • Maintain cultures in bioreactors with controlled light regimes

    • Sample at regular intervals across diurnal cycles

This multi-faceted approach, as demonstrated with Synechocystis sp. PCC 6803, allows for comprehensive characterization of ATP synthase function under various physiological conditions .

What genetic manipulation techniques are most effective for studying atpB1 function in Cyanothece sp.?

TechniqueApplicationEfficiencyKey Considerations
CRISPR-Cas9Precise gene editingModerate in cyanobacteriaPAM site availability, off-target effects
Homologous recombinationGene replacementWell-establishedRequires long homology arms
Transposon mutagenesisRandom insertional mutagenesisHigh throughputLess specific, requires screening
Site-directed mutagenesisSpecific amino acid changesHigh precisionRequires expression system

For studying atpB1 function in Cyanothece sp., researchers should consider:

  • Natural transformation or electroporation for DNA delivery

    • Optimize DNA concentration and growth phase for maximum efficiency

    • Use methylation-deficient E. coli strains to prepare DNA if restriction is an issue

  • Selection strategy

    • Use antibiotic resistance markers appropriate for cyanobacteria

    • Consider marker-less systems for multiple genetic manipulations

  • Verification methods

    • PCR, sequencing, and Southern blot to confirm genetic modifications

    • Transcriptional analysis using RT-PCR or RNA-Seq

    • Proteomic confirmation by Western blot or mass spectrometry

  • Phenotypic characterization

    • Growth rate analysis under various light conditions

    • ATP synthesis/hydrolysis assays as described above

    • Oxygen evolution measurements to assess photosynthetic function

These approaches have been successfully applied to study ATP synthase components in related cyanobacteria and would be applicable to Cyanothece sp. .

How should researchers interpret ATP synthase activity data in relation to diurnal rhythms in Cyanothece sp.?

When analyzing ATP synthase activity in relation to diurnal rhythms in Cyanothece sp., researchers should consider:

  • Temporal patterns of activity

    • Compare ATP synthesis and hydrolysis rates across the diurnal cycle

    • Correlate with transcriptional and translational regulation patterns

    • Analyze in context of nitrogen fixation periods and glycogen metabolism

  • Statistical approaches

    • Use time-series analysis methods appropriate for cyclical data

    • Apply ANOVA with post-hoc tests for comparing multiple time points

    • Consider using circadian rhythm analysis tools like JTK_CYCLE or ARSER

  • Integrated data analysis

    • Correlate ATP synthase activity with photosynthetic and respiratory measurements

    • Compare with transcriptomic data for related metabolic pathways

    • Develop mathematical models that account for the interrelationship between nitrogen fixation and energy metabolism

Research with Cyanothece sp. ATCC 51142 has shown that approximately 10% of genes demonstrate circadian behavior, with nitrogen fixation genes showing particularly strong regulation . When interpreting ATP synthase activity data, it's critical to consider how its function integrates with these circadian patterns, particularly the temporal separation of nitrogen fixation and photosynthesis .

What are the methodological challenges in comparing ATP synthase regulation between different cyanobacterial species?

Comparative studies of ATP synthase regulation between Cyanothece sp. and other cyanobacteria face several methodological challenges:

  • Genetic and physiological differences

    • Diazotrophic vs. non-diazotrophic species have different energy requirements

    • Variation in membrane organization and thylakoid arrangement

    • Species-specific regulatory proteins like AtpΘ may have different expression patterns or binding affinities

  • Experimental standardization difficulties

    • Growth conditions must be optimized for each species

    • Membrane isolation protocols may require species-specific modifications

    • Activity assay conditions may affect different species differently

  • Interpretation complexities

    • Direct comparison of absolute activity values may be misleading

    • Regulatory mechanisms may serve different physiological roles

    • Evolutionary adaptations may result in similar outputs through different mechanisms

To address these challenges, researchers should:

  • Standardize measurements relative to internal controls within each species

  • Focus on response patterns rather than absolute values

  • Use multiple complementary techniques to validate findings

  • Apply systems biology approaches to understand regulation in the context of the entire metabolic network

Studies comparing ATP synthase function between Synechocystis sp. PCC 6803 and Thermosynechococcus elongatus BP-1 demonstrated that while both showed light-dependent regulation of ATPase activities, the specific mechanisms and magnitude of regulation differed .

How can researchers distinguish between direct effects on ATP synthase subunit a versus indirect regulatory effects?

Distinguishing direct effects on ATP synthase subunit a from indirect regulatory effects requires a multi-layered experimental approach:

  • In vitro reconstitution experiments

    • Purify recombinant subunit a and reconstitute with other ATP synthase components

    • Systematically vary subunit composition to isolate specific contributions

    • Measure activity with controlled proton gradients to eliminate upstream effects

  • Site-directed mutagenesis

    • Target specific residues in subunit a predicted to be involved in function or regulation

    • Create point mutations that preserve structure but alter specific properties

    • Compare effects on ATP synthesis, hydrolysis, and proton translocation

  • Protein-protein interaction studies

    • Use pull-down assays, cross-linking, or two-hybrid systems to identify direct binding partners

    • Apply surface plasmon resonance or isothermal titration calorimetry to quantify binding affinities

    • Map interaction domains through deletion constructs or peptide competition assays

  • Time-resolved studies

    • Monitor the sequence of events following perturbation (e.g., light-dark transition)

    • Compare the kinetics of changes in ATP synthase activity with other cellular responses

    • Use rapid quenching techniques to capture transient states

Research on ATP synthase in Synechocystis has demonstrated that direct protein-protein interactions, such as those involving the small protein AtpΘ, play important roles in regulating activity . Similar approaches could be applied to study subunit a in Cyanothece sp., particularly focusing on interactions that might be specific to diazotrophic cyanobacteria with their unique energy management requirements .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.