Recombinant Cyanothece sp. Cytochrome b6-f complex iron-sulfur subunit (petC)

Shipped with Ice Packs
In Stock

Description

Key Features of the Recombinant Protein:

PropertyDetailsSource
Source OrganismCyanothece sp. (e.g., PCC 7425, ATCC 51142)
Protein LengthFull-length (1–180 amino acids)
TagN-terminal His₆ tag for purification via Ni²⁺-affinity chromatography
Molecular Weight~20–25 kDa (estimated)
FunctionFacilitates electron transfer by binding quinones; stabilizes the cytochrome b6-f complex

Purification:

  • Ni²⁺-affinity chromatography isolates the His-tagged protein to >90% purity.

  • Storage: Lyophilized or in Tris/PBS buffer with 6% trehalose at -20°C .

Electron Transport and Redox Regulation:

  • Photosynthesis: Mediates electron transfer between plastohydroquinone (PQH₂) and plastocyanin (PC) in the cytochrome b6-f complex.

  • Respiration: Contributes to linear electron transport chains under aerobic conditions.

Isoform Specificity:

  • PetC1: Dominant isoform under aerobic conditions.

  • PetC2: Upregulated under low-oxygen stress, suggesting adaptation to hypoxic environments .

  • PetC3: Lower redox potential; potential role in alternative electron pathways (e.g., with donors like menaquinone) .

Biotechnological Potential

  • Biofuel Production: Engineered Cyanothece strains (e.g., PCC 7425) express heterologous enzymes (e.g., limonene synthase) for terpene synthesis .

  • Biosensors: Polysaccharides from Cyanothece show metal-binding capacity, though petC itself is not directly linked to this trait .

Key Challenges:

  1. Functional Redundancy: Overlapping roles of PetC isoforms complicate precise functional dissection.

  2. Heterologous Expression: Low yields or misfolding in E. coli require optimization of codon usage or chaperone co-expression.

Future Research:

  • Structural Dynamics: Time-resolved spectroscopy to study redox-dependent conformational changes.

  • Synthetic Biology: Engineering petC variants with enhanced electron transfer rates for bioelectrochemical systems.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
petC; Cyan7425_1419; Cytochrome b6-f complex iron-sulfur subunit; Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein; ISP; RISP; Rieske iron-sulfur protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Cyanothece sp. (strain PCC 7425 / ATCC 29141)
Target Names
petC
Target Protein Sequence
MAQLSGTPDVPDMGRRQFMNLLTFGSATGVALGMLYPVVRYFIPPASGGVGGGVVAKDAL GNDISVSDFLAKHPANDRALAQGLKGDPTYIVVQDDHTIGDYGLNAVCTHLGCVVPWNIS ENKFICPCHGSQYDNTGKVVRGPAPLSLALAHAAVSDDKITFTPWTETDFRTGKEPWWT
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex. This complex facilitates electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Database Links
Subcellular Location
Cellular thylakoid membrane; Single-pass membrane protein.

Q&A

What is the structure and composition of the cytochrome b6-f complex in cyanobacteria?

The cytochrome b6-f complex is a dimeric membrane protein complex with a molecular weight of approximately 220,000 Da. Each monomer contains eight different transmembrane polypeptide subunits, with a total monomer mass of approximately 108,535 Da in Mastigocladus laminosus (a thermophilic cyanobacterium) . Three of these polypeptides bind electron transfer cofactors: cytochrome b6 (binding two b hemes and a newly discovered heme x), cytochrome f (binding a c-type heme), and the Rieske iron-sulfur protein (binding an Fe2S2 cluster) .

The subunit composition of the cytochrome b6-f complex from M. laminosus is detailed in the following table:

SubunitCalculated Mass (Da)Measured Mass (Da)
PetA (cyt f)3227032270
PetB (cyt b6)2488424710
PetC (Rieske iron-sulfur protein)1920219295
PetD (subunit IV)1752217528
PetGn/a4057
PetM38423841
PetL35303530
PetN33043304
Total mass of the monomern/a108535

The structure of the cytochrome b6-f complex is highly conserved across different photosynthetic organisms, with structures from the cyanobacterium M. laminosus and the green alga Chlamydomonas reinhardtii showing remarkable similarity despite being separated by approximately one billion years of evolution .

How does the petC gene product function in the electron transfer pathway?

The petC gene encodes the Rieske iron-sulfur protein, which contains an Fe2S2 cluster that participates in electron transfer on the p-side (positive/periplasmic side) of the b6-f complex. During the Q-cycle, plastoquinol (PQH2) is oxidized at the Qp site, where the Fe2S2 cluster of the Rieske protein accepts one electron from PQH2, while the other electron is transferred to heme bp of cytochrome b6 .

The Fe2S2 cluster-binding domain of the iron-sulfur protein docks into the Qp pocket from the p-side aqueous phase through contacts with the cd1 and cd2 helices of cytochrome b6 and the "ef" helical loop of subunit IV . These regions are among the most conserved in the b6-f complex, highlighting their functional importance. The electron accepted by the Fe2S2 cluster is subsequently transferred to cytochrome f and then to plastocyanin or cytochrome c6, completing the high-potential electron transfer pathway.

What are the key structural features of the Rieske iron-sulfur protein in cyanobacteria?

The Rieske iron-sulfur protein in cyanobacteria consists of a membrane-anchored domain and a soluble domain that contains the Fe2S2 cluster. The soluble domain is mobile and can adopt different conformations during the electron transfer process. The Fe2S2 cluster is coordinated by two histidine and two cysteine residues, with the histidine coordination being critical for the relatively high redox potential of this cluster compared to other iron-sulfur clusters .

The width of the Qp pocket, where the Fe2S2 cluster-binding domain docks, varies between species. In the cyanobacterial complex (M. laminosus), this pocket is narrower than in the algal complex (C. reinhardtii) due to an approximately 2 Å shift of the ef helix and the C-terminal region of the E helix . As a result, the iron-sulfur protein in the algal complex can penetrate about 3 Å deeper into the Qp site, which may influence the efficiency of electron transfer.

How can recombinant Cyanothece sp. petC be successfully expressed and purified for structural and functional studies?

For successful expression and purification of recombinant Cyanothece sp. petC, researchers should consider adapting genetic tools developed for model cyanobacteria. Based on the successful genetic manipulation of Cyanothece PCC 7425, a promising approach would be to use plasmid vectors derived from the broad-host-range plasmid RSF1010, which has been demonstrated to replicate autonomously in Cyanothece PCC 7425 .

The expression construct should be designed with appropriate promoters, such as the strong λpR promoter used in the pC plasmid system, which has been shown to enable high-level constitutive gene expression in Cyanothece PCC 7425 . When designing the expression construct, codon optimization should be considered; the codon usage of Synechocystis PCC 6803 has been successfully applied to genes expressed in Cyanothece PCC 7425 due to their similar codon preferences .

What are the challenges in ensuring proper incorporation of the Fe2S2 cluster in recombinant petC proteins?

Ensuring proper incorporation of the Fe2S2 cluster in recombinant petC proteins presents several challenges that researchers must address:

  • Co-expression of assembly factors: The Fe2S2 cluster in the Rieske protein requires specific assembly factors for proper incorporation. In heterologous expression systems, these factors may be absent or insufficient. Co-expression of the necessary assembly factors from the native organism may improve cluster incorporation.

  • Iron and sulfur availability: Supplementation of the growth medium with iron and sulfur sources can enhance Fe2S2 cluster formation. Addition of iron (as ferric ammonium citrate) and cysteine (as a sulfur source) to the growth medium has been shown to improve cluster incorporation in other recombinant iron-sulfur proteins.

  • Redox environment: The redox environment of the expression host can affect Fe2S2 cluster assembly and stability. Growing cells under microaerobic conditions or using host strains with reduced cytoplasmic redox potential may improve cluster incorporation.

  • Membrane association: The Rieske protein is normally anchored to the membrane, which may be essential for proper folding and cluster incorporation. Expression strategies that maintain this membrane association, such as using membrane-targeted expression systems, may improve the yield of correctly folded protein.

How do structural differences in the Qp pocket between cyanobacterial species affect electron transfer kinetics and efficiency?

The structural differences in the Qp pocket between cyanobacterial species have significant implications for electron transfer kinetics and efficiency. As observed between M. laminosus and C. reinhardtii, variations in the width of the Qp pocket (due to shifts in the ef helix and C-terminal region of the E helix) affect how deeply the Fe2S2 cluster-binding domain can penetrate into this site .

A wider Qp pocket, as found in the algal complex, allows deeper penetration of the iron-sulfur protein, potentially positioning the Fe2S2 cluster closer to its electron donor (plastoquinol) and acceptor molecules. This closer proximity could reduce the electron transfer distance, potentially increasing the electron transfer rate according to Marcus theory, which predicts an exponential decrease in electron transfer rates with increasing distance.

Researchers investigating these differences could employ site-directed mutagenesis to alter specific residues in the ef helix and observe the effects on electron transfer rates and quinol binding. Combined with time-resolved spectroscopy, such studies could correlate structural differences with functional consequences.

What genetic manipulation techniques can be used to study petC function in Cyanothece species?

Several genetic manipulation techniques have been developed for Cyanothece species that can be applied to study petC function:

  • Conjugative transfer: A simple and efficient protocol for conjugative transfer of plasmid vectors to Cyanothece PCC 7425 has been developed using vectors derived from the broad-host-range plasmid RSF1010 . This method allows for the introduction of recombinant DNA into Cyanothece cells without the need for electroporation or chemical transformation, which can be challenging with cyanobacteria.

  • Promoter analysis: The genetic toolbox developed for Cyanothece PCC 7425 includes tools for promoter analysis, which can be used to study the regulation of petC gene expression under different environmental conditions or developmental stages .

  • Protein production systems: Both constitutive and temperature-controlled protein production systems have been developed for Cyanothece PCC 7425 . These systems can be used to express modified versions of the petC gene or to overexpress the native protein for functional studies.

  • Subcellular localization analysis: Tools for analyzing the subcellular localization of proteins are available for Cyanothece PCC 7425 . These can be used to study the membrane association and dynamics of the petC gene product during photosynthesis and respiration.

  • Gene replacement: Though not specifically mentioned in the search results for Cyanothece, homologous recombination-based gene replacement strategies commonly used in other cyanobacteria could be adapted to create petC knockout or site-directed mutants in Cyanothece species.

What are the best approaches for resolving conflicting experimental data regarding petC function in different cyanobacterial species?

When faced with conflicting experimental data regarding petC function across different cyanobacterial species, researchers should consider the following approaches:

  • Standardize experimental conditions: Ensure that comparisons between species are made under identical growth conditions, including light intensity, temperature, nutrient availability, and growth phase. As observed with limonene production in Cyanothece PCC 7425, even small changes in light intensity (from 2000 to 1500 lux) or temperature (from 30°C to 34°C) can affect metabolic processes .

  • Cross-species complementation studies: Express the petC gene from one species in a petC-deficient strain of another species to directly assess functional conservation or divergence. This approach can reveal whether observed differences are due to the protein itself or its interaction with other cellular components.

  • Structural biology approaches: Obtain high-resolution structures of the cytochrome b6-f complex from the species in question, similar to the comparative analysis between M. laminosus and C. reinhardtii . This can reveal structural differences that might explain functional variations.

  • Evolutionary context analysis: Consider the evolutionary relationship between the species being compared. As noted in search result , structures of the cytochrome b6-f complex from organisms separated by 10^9 years of evolution are remarkably similar, suggesting strong functional conservation. Significant functional differences might indicate adaptation to specific ecological niches.

  • Multi-laboratory validation: Organize collaborative studies where the same experiments are performed in different laboratories using standardized protocols. This approach can identify methodological variables that might contribute to conflicting results.

  • Integrated omics approach: Combine proteomics, transcriptomics, and metabolomics to develop a systems-level understanding of how petC functions within the larger context of cellular metabolism in different species. This may reveal compensatory mechanisms that mask or modify the phenotypic effects of petC variations.

How should researchers design experiments to study the assembly and stability of the cytochrome b6-f complex in Cyanothece sp.?

Studying the assembly and stability of the cytochrome b6-f complex in Cyanothece sp. requires carefully designed experiments that address the complex nature of membrane protein assembly:

  • Pulse-chase experiments: Use radiolabeled amino acids or stable isotopes in pulse-chase experiments to track the synthesis, assembly, and turnover of individual subunits of the complex. This can reveal the order of assembly and identify rate-limiting steps.

  • Conditional expression systems: Develop temperature-sensitive or inducible promoter systems for key subunits, including petC, to control their expression. This allows researchers to synchronize the assembly process across a cell population and follow the assembly kinetics more precisely.

  • Fluorescent protein tagging: Generate fusion proteins with fluorescent tags for real-time monitoring of protein localization and complex formation. Care must be taken to ensure that tags do not interfere with protein function or complex assembly.

  • Blue native PAGE analysis: Use blue native polyacrylamide gel electrophoresis to separate intact protein complexes and monitor the formation of assembly intermediates. This technique has been successfully used to study the assembly of photosynthetic complexes in cyanobacteria.

  • In vivo crosslinking: Apply chemical crosslinking agents to capture transient protein-protein interactions during complex assembly. Combined with mass spectrometry, this approach can identify interaction partners and assembly factors.

  • Stability assays: Assess complex stability under various environmental conditions (temperature, pH, salt concentration) to understand the factors that affect the integrity of the assembled complex. This is particularly relevant for understanding how environmental stresses impact photosynthetic efficiency.

What bioinformatic approaches can be used to identify conserved functional domains in petC across different cyanobacterial species?

To identify conserved functional domains in petC across different cyanobacterial species, researchers can employ the following bioinformatic approaches:

  • Multiple sequence alignment (MSA): Align petC sequences from diverse cyanobacterial species to identify highly conserved regions, which often correlate with functional importance. Tools like Clustal Omega, MUSCLE, or T-Coffee can be used for this purpose.

  • Phylogenetic analysis: Construct phylogenetic trees based on petC sequences to understand the evolutionary relationships and potential functional divergences. This can help identify clades with potentially specialized functions.

  • Structural modeling and comparison: Use homology modeling to predict the structure of petC proteins from different species based on known structures, such as that from M. laminosus . Compare these models to identify structurally conserved regions that may be functionally important.

  • Coevolution analysis: Identify residues that show coordinated evolutionary changes, which often indicates functional coupling. Methods such as Direct Coupling Analysis (DCA) or Mutual Information (MI) can reveal networks of coevolving residues.

  • Domain prediction tools: Use software like PFAM, SMART, or InterProScan to identify known functional domains and motifs in petC sequences.

  • Conservation mapping onto structure: Map sequence conservation scores onto three-dimensional structures to visualize conserved patches, which often correspond to functional sites like the Fe2S2 cluster binding region or interaction interfaces with other components of the cytochrome b6-f complex.

  • Transmembrane topology prediction: Use tools like TMHMM or Phobius to predict transmembrane regions and compare these predictions across species to identify conserved membrane topology features.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.