Recombinant Cyanothece sp. Cytochrome c biogenesis protein CcsB (ccsB)

Shipped with Ice Packs
In Stock

Description

Introduction

Cytochrome $$c$$ biogenesis is essential for electron transport and energy production in many organisms . This process involves several complex systems to facilitate the transport, reduction, and ligation of heme to the apoprotein . Among these, System II is a key pathway utilized by Gram-positive bacteria, cyanobacteria, some proteobacteria, and chloroplasts . Within System II, the CcsB protein plays a critical role, often in conjunction with CcsA, to form a cytochrome $$c$$ synthetase complex . In some organisms, including Helicobacter hepaticus, the CcsB and CcsA proteins are fused into a single open reading frame (ORF), forming CcsBA .

This article aims to provide a detailed overview of Recombinant Cyanothece sp. Cytochrome $$c$$ biogenesis protein CcsB (CcsB), its structure, function, and significance in cytochrome $$c$$ biogenesis.

Role of CcsB in Cytochrome $$c$$ Biogenesis System II

System II typically comprises four proteins: CcsB, CcsA, DsbD, and CcsX, but only CcsB and CcsA are essential for function . CcsB, along with CcsA, forms the cytochrome $$c$$ synthase, which is responsible for channeling heme to an external heme-binding domain for stereospecific attachment to cytochrome $$c$$ .

Functional Analysis and Heme Binding

CcsBA functions as both a heme transporter and a cytochrome $$c$$ synthetase . It transports heme across the membrane and positions it for covalent attachment to apocytochrome $$c$$ . The protein contains a conserved motif called the WWD domain, which is part of the heme-handling protein (HHP) superfamily .

Key findings include:

  • Heme Binding Sites: CcsBA has two heme-binding domains: a transmembrane (TM) heme-binding site and an external heme-binding WWD domain .

  • Histidine Ligands: Conserved histidine residues in the transmembrane domains (TM-His1 and TM-His2) and the WWD domain (P-His1 and P-His2) serve as ligands for heme binding .

  • Heme Protection: The external heme-binding domain protects heme from oxidation, which is essential for its function in cytochrome $$c$$ biogenesis .

Proposed Mechanism of Cytochrome $$c$$ Biogenesis by CcsBA

Based on structural and functional analyses, a mechanistic model for cytochrome $$c$$ biogenesis by CcsBA has been proposed :

  1. Heme Translocation: The TMDs of CcsBA form a channel for heme translocation across the membrane .

  2. Initial Heme Binding: Reduced heme from the cytoplasm binds to a low-affinity binding site within the transmembrane region, coordinated by specific histidine residues (e.g., His-77 and His-858 in H. hepaticus CcsBA) .

  3. Transfer to External Domain: Heme is then transferred to a high-affinity external heme-binding domain, where it is ligated and protected from oxidation by other histidine residues (e.g., His-761 and His-897) .

  4. Apocytochrome $$c$$ Binding: The WWD domain orients the heme, positioning its vinyl groups near the reduced thiols of the apocytochrome $$c$$ CXXCH motif for thioether bond formation .

  5. Ligand Exchange: A ligand exchange occurs, where a histidine from the CXXCH motif replaces one of the histidine ligands in the WWD domain .

  6. Heme Release: The final step involves the formation of the sixth axial ligand of cytochrome $$c$$, which facilitates heme release and folding into its mature form .

Redox Requirements and the Role of Dsb System

The function of CcsBA is influenced by the redox environment. Under aerobic conditions, DsbC and DsbD are required for its function, while under anaerobic conditions, only DsbD is necessary . This indicates the importance of disulfide bond formation and reduction in the cytochrome $$c$$ biogenesis process.

Significance and Future Directions

Understanding the structure and function of CcsB and CcsBA is crucial for elucidating the mechanisms of heme trafficking and cytochrome $$c$$ biogenesis . Further research, including structural determination and detailed mechanistic studies, will provide deeper insights into the roles of CcsB and CcsBA in various organisms.

Table Summarizing Key Features of CcsB

FeatureDescription
FunctionPart of the cytochrome $$c$$ synthetase complex, involved in heme trafficking and attachment to apocytochrome $$c$$
StructureIntegral membrane protein with multiple transmembrane domains (10 TMDs in CcsBA from H. hepaticus)
Heme BindingContains transmembrane and external (WWD domain) heme-binding sites
Histidine LigandsConserved histidine residues in TMDs and WWD domain coordinate heme binding
Redox DependenceRequires DsbC and DsbD under aerobic conditions; DsbD under anaerobic conditions
Organism DistributionFound in Gram-positive bacteria, cyanobacteria, some proteobacteria, and chloroplasts

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ccsB; ccs1; cce_4132; Cytochrome c biogenesis protein CcsB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-451
Protein Length
full length protein
Species
Cyanothece sp. (strain ATCC 51142)
Target Names
ccsB
Target Protein Sequence
MTISDSPQTPENLSLPKQGFRQLIKIVADLRLAIVLLLAIALFSISGTVIEQGETISFYQ QNYPEDPALFGFLTWKVILILGLNHVYTTWWFLSLLVLFGTSLTTCTFTRQFPALKAARK WNFYQKARQFEKLALSTELAINDLKFVNNLLEQKGYKTFQENQAIYARKGIIGKIGPIVV HAAMLIILGGAIWGALTGFLAQAMVPTGSEFKVNNIIEAGPLSQPQIPKDWGIRVNRFWI DYTPDGTIDQFYSDLSVINNDGEELKHKTIYVNEPLRYHGVTFYQTDWGIAGVQAQVNNS PIFQLPMALLNTNGNGRIWGTWIPTKPDLSEGVSLLAKDLQGTMMVYDQKGDLYSAVRPG MILDINGVRLKIYQLIGSTGLQIKADPGIPFVYTGFGLLMMGVIMSYVSHSQIWVLQEDE HCYIGGKTNRSQVTFERELLGIIESLEPEKT
Uniprot No.

Target Background

Function
Essential for the biogenesis of c-type cytochromes (cytochrome c6 and cytochrome f), specifically during heme attachment.
Database Links
Protein Families
Ccs1/CcsB family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.