Recombinant Cyanothece sp. Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Enzymatic Function and Substrate Specificity

PlsY demonstrates unique substrate preferences compared to homologs in other cyanobacteria:

  • Primary Substrate: Myristoyl-acyl carrier protein (14:0-ACP), enabling esterification of G3P with myristic acid at the sn-1 position .

  • Secondary Activity: Minor activity toward palmitoyl-ACP (16:0-ACP) under experimental conditions .

Heterologous expression in Synechococcus elongatus PCC 7942 resulted in a 20-fold increase in myristic acid content (from 0.5% to 10% of total fatty acids) , highlighting its role in modulating lipid composition.

Metabolic Engineering

  • Fatty Acid Production: Co-expression of PlsY with Δ9-fatty acid desaturase (DesC) in Synechococcus increased myristoleic acid (14:1) to 9% and palmitoleic acid (16:1) to 49%, demonstrating synergistic effects for unsaturated fatty acid synthesis .

  • Lipid Remodeling: PlsY overexpression shifts glycerolipid profiles toward C14-rich species, as shown below:

Strain14:0 (%)16:0 (%)16:1 (%)
Wild-type Synechococcus0.55032
Synechococcus + PlsY101549

Biotechnological Potential

  • Biofuel Feedstock: Enhanced C14 fatty acid production supports biodiesel optimization due to favorable combustion properties .

  • Genetic Stability: Recombinant PlsY-expressing strains maintain consistent lipid profiles over multiple generations, critical for industrial scalability .

Challenges and Future Directions

  • Substrate Competition: Endogenous acyl-ACP pools in hosts like E. coli may limit PlsY activity, necessitating chassis engineering .

  • Thermostability: Optimization for industrial processes requires stability above 30°C .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All protein shipments are standardly packed with blue ice packs. If you require dry ice packaging, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
plsY; cce_3656; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Cyanothece sp. (strain ATCC 51142)
Target Names
plsY
Target Protein Sequence
MAFLISALLILIGYLLGSIPTGYLTGLHLKGIDVRQHGSGSTGATNILRTIGKRAAIFVL TVDLAKAMLAVILVKLWFFVESPEMIPLEWKSWLVVFAAIAAVLGHSKSIFLNFTGGKSV ASSLGVLLVLNPIVALGTLGSFLAMLSLSRIVSLSSITGVVAVNVLMFGLHQPLPYCLFG VIVGLYVTFRHRTNIIRLLQGTEPRLGQKLQQEGS
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). It utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of glycerol-3-phosphate acyltransferase (PlsY) in bacterial metabolism?

PlsY functions as an integral membrane protein that catalyzes the transfer of acyl groups from acylphosphate to glycerol-3-phosphate in the initial step of phosphatidic acid formation for bacterial membrane phospholipid biosynthesis. This pathway typically involves the conversion of acyl-acyl carrier protein to acylphosphate by PlsX, followed by the PlsY-mediated transfer to glycerol-3-phosphate. This represents the most widely distributed biosynthetic pathway for initiating phospholipid synthesis in bacterial systems, making it a fundamental component of bacterial membrane formation .

How does PlsY enzyme structure relate to its function?

Studies of PlsY from bacterial species like Streptococcus pneumoniae reveal that PlsY typically contains five membrane-spanning segments with the amino terminus and two short loops located on the external face of the membrane. The enzyme contains three larger cytoplasmic domains, each featuring highly conserved sequence motifs critical for catalysis. Specifically, Motif 1 contains essential serine and arginine residues, Motif 2 functions as a phosphate-binding loop containing the glycerol-3-phosphate binding site, and Motif 3 includes conserved histidine and asparagine residues important for activity along with a structurally critical glutamate residue .

What are the recommended approaches for cloning and expressing recombinant proteins from Cyanothece sp.?

Based on successful protocols used with other Cyanothece proteins, genomic DNA isolation from Cyanothece sp. can be effectively performed using the cetyltrimethylammonium bromide (CTAB) method. For a typical preparation, approximately 50 mg of frozen cell material should be resuspended in CTAB buffer (2% w/v CTAB, 100 mM Tris-HCl pH 8, 20 mM EDTA pH 8, 1.4 M NaCl) containing 2% (v/v) β-mercaptoethanol. After incubation at 65°C for 3 hours, extraction with chloroform/isoamyl alcohol, followed by DNA precipitation and washing with ethanol, yields genomic DNA suitable for PCR amplification of target genes. Expression in E. coli has proven successful for other Cyanothece enzymes and would likely be applicable to PlsY .

What methods are most effective for studying membrane topology of bacterial acyltransferases like PlsY?

The substituted cysteine accessibility method (SCAM) has proven particularly effective for determining membrane topology of bacterial membrane proteins including PlsY. This technique involves systematically introducing cysteine residues throughout the protein sequence, followed by selective labeling of accessible cysteines with membrane-permeable or impermeable reagents. The pattern of labeling helps determine which protein regions are exposed to either side of the membrane and which segments span the membrane. This approach was successfully used to elucidate the five membrane-spanning segments of Streptococcus pneumoniae PlsY and could be adapted for Cyanothece sp. PlsY .

How can researchers effectively measure the enzymatic activity of recombinant PlsY?

Enzymatic activity of PlsY can be assessed by measuring the transfer of acyl groups from acylphosphate to glycerol-3-phosphate. A typical assay would monitor the disappearance of acylphosphate or the formation of acylated glycerol-3-phosphate using chromatographic or spectrophotometric methods. When designing activity assays, researchers should be aware that PlsY is noncompetitively inhibited by palmitoyl-CoA. Additionally, site-directed mutagenesis of conserved residues in the three motifs can provide valuable insights into structure-function relationships, as demonstrated with S. pneumoniae PlsY, where mutations in Motif 2 specifically affected the Km for glycerol-3-phosphate binding .

How might PlsY function integrate with the unique photosynthetic and nitrogen-fixing metabolism of Cyanothece sp.?

Cyanothece sp. ATCC 51142 exhibits a complex metabolism that temporally separates photosynthesis and glycogen accumulation from nitrogen fixation. The membrane lipid composition, which depends on acyltransferases like PlsY, likely plays a crucial role in supporting these distinct metabolic modes. Research questions could explore how membrane phospholipid composition changes during the transition between photosynthetic and nitrogen-fixing states, and whether PlsY activity or expression is regulated in a circadian manner. Given that photosynthetic and respiratory electron transport chains in cyanobacteria share membrane components, investigating how membrane lipid composition affects these processes could provide insights into the metabolic versatility of Cyanothece sp. .

What are the potential differences between PlsY from Cyanothece sp. and other bacterial species?

While the core catalytic function of PlsY is likely conserved across bacterial species, cyanobacteria like Cyanothece may have evolved specific adaptations in their PlsY enzymes to accommodate their unique photosynthetic lifestyle. Potential research questions include: Does Cyanothece PlsY show substrate preferences that differ from non-photosynthetic bacteria? Are there structural adaptations that allow integration with photosynthetic membranes? Comparative analysis of PlsY sequences from diverse bacteria, combined with functional studies, could reveal cyanobacteria-specific features of the enzyme .

How does light quality and intensity affect membrane lipid metabolism in Cyanothece sp.?

Genome-scale modeling of Cyanothece sp. indicates that growth and metabolic flux distributions are substantially impacted by the relative amounts of light going into individual photosystems. Given that membrane lipids form the structural basis for these photosystems, an important research question is how light conditions affect the expression and activity of enzymes involved in membrane lipid biosynthesis, including PlsY. Experiments using different monochromatic light sources (such as 630 nm and 680 nm light) could help elucidate how specific wavelengths affect membrane composition and PlsY activity .

What approaches are recommended for analyzing site-directed mutagenesis results for membrane proteins like PlsY?

Analysis of site-directed mutagenesis results for PlsY should focus on both kinetic parameters and structural integrity. Based on studies with S. pneumoniae PlsY, mutations in different conserved motifs can affect either substrate binding (changing Km) or catalytic efficiency (altering Vmax). Additionally, some mutations, particularly in Motif 3, may affect the structural integrity of the enzyme. Researchers should therefore combine kinetic analyses with structural assessments such as circular dichroism or limited proteolysis to distinguish between effects on catalysis versus protein folding. Comparison with mutagenesis data from PlsY enzymes of other species can help identify conserved versus species-specific functional residues .

How can researchers integrate PlsY functional data with genome-scale models of Cyanothece metabolism?

The existing genome-scale metabolic model for Cyanothece sp. ATCC 51142 (iCce806) provides a valuable framework for integrating enzyme-level data into systems-level understanding. To incorporate PlsY functional data into this model, researchers should:

ParameterExperimental ConditionObserved EffectRelevance to PlsY Research
Growth Rate630 nm light (PS II)Higher intensity correlates with increased growthMembrane synthesis demand increases with growth
Growth Rate680 nm light (PS I)Higher intensity correlates with increased growthMembrane composition may adapt to different light qualities
Electron TransportPS II flux limitationExcess electron carriers removed via cyclic transportMembrane lipid composition affects electron transport efficiency
Metabolic BalancePS I flux limitationTerminal respiratory oxidases remove excess reductantMembrane protein function depends on appropriate lipid environment

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.