Recombinant Cyanothece sp. Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Fundamental Characteristics of Lipoprotein Signal Peptidase

Lipoprotein signal peptidase (lspA), also known as signal peptidase II or SPase II, is a membrane-bound enzyme responsible for the essential processing of prolipoproteins in bacteria. In cyanobacteria, this enzyme plays a crucial role in the maturation pathway of lipoproteins by cleaving the signal peptide from prolipoproteins after lipid modification, enabling proper localization and function of these proteins within cellular membranes. The lspA from Synechocystis sp., which serves as a valuable reference point for understanding Cyanothece sp. lspA, is characterized as a relatively small protein comprising 161 amino acids with multiple transmembrane domains that anchor it within the membrane bilayer . These enzymes typically contain conserved domains that are critical for recognizing and processing the signal sequences of prolipoproteins, ultimately facilitating their integration into membrane systems.

Physiological Significance in Cyanobacterial Systems

In cyanobacteria, lipoprotein signal peptidases contribute significantly to cellular envelope integrity and function by ensuring proper processing of lipoproteins that populate various membrane compartments. The importance of these enzymes is particularly pronounced in photosynthetic organisms like Cyanothece sp., where membrane organization and protein trafficking are tightly regulated to support the complex physiological processes of photosynthesis and nitrogen fixation. The lspA enzyme likely participates in the processing of proteins involved in photosynthetic complexes, respiratory chains, and potentially components of the nitrogen fixation apparatus, though direct experimental evidence of these specific roles in Cyanothece sp. remains to be established through targeted research. The enzyme's activity may be integrated into the elaborate regulatory networks that orchestrate the temporal separation of photosynthesis and nitrogen fixation in diazotrophic cyanobacteria such as Cyanothece sp. ATCC 51142 .

Biological Significance and Metabolic Capabilities

Cyanothece sp. represents a remarkable group of unicellular diazotrophic cyanobacteria that have garnered significant scientific interest due to their distinctive physiological attributes. Unlike many photosynthetic organisms, Cyanothece sp. ATCC 51142 possesses the dual capabilities of oxygenic photosynthesis and nitrogen fixation within the same cell, despite the inherent biochemical incompatibility of these processes . This remarkable feat is achieved through a sophisticated temporal separation strategy whereby photosynthesis occurs predominantly during daylight hours while nitrogen fixation is confined to the night phase . This temporal segregation is reflected in the transcriptional program of Cyanothece, with approximately 30% of its genome exhibiting robust oscillating expression patterns synchronized with the diurnal cycle . The cellular architecture of Cyanothece features thylakoids that protrude radially into the cytoplasm from several poles along the cytoplasmic membrane, differing from the concentric arrangement observed in other cyanobacteria like Synechococcus .

Transcriptomic Landscape and Regulatory Networks

Comprehensive transcriptomic analysis of Cyanothece 51142 has revealed remarkable coordination in the expression patterns of genes involved in central metabolic pathways. During a day-night cycle, the intracellular environment oscillates between aerobic and anaerobic conditions to accommodate the contrasting requirements of photosynthesis and nitrogen fixation . Nearly 5,000 genes have been examined across consecutive diurnal periods, showing that approximately 30% exhibit robust oscillating expression profiles, including genes essential for nearly all central metabolic processes . Interestingly, genes encoding enzymes for specific biochemical pathways such as glycolysis, oxidative pentose phosphate pathway, and glycogen metabolism display coordinated regulation, with maximal expression occurring at specific phases of the diurnal cycle . This orchestrated gene expression program likely extends to membrane-associated processes involving lipoproteins, suggesting potential temporal regulation of lspA activity in synchrony with the broader metabolic transitions between photosynthetic and nitrogen-fixing states.

Expression Systems for Cyanobacterial Membrane Proteins

The production of recombinant cyanobacterial membrane proteins, including lipoprotein signal peptidases, presents significant technical challenges due to their hydrophobic nature and specific folding requirements. Escherichia coli remains the predominant heterologous expression system for these proteins, offering advantages of rapid growth, genetic tractability, and established protocols for membrane protein production. The successful expression of recombinant Synechocystis sp. lipoprotein signal peptidase in E. coli, as demonstrated in the available literature, provides a methodological framework that could be adapted for the production of Cyanothece sp. lspA . In such systems, the protein is typically fused to affinity tags, such as polyhistidine sequences, to facilitate subsequent purification and characterization. The expression conditions, including temperature, induction parameters, and host strain selection, require careful optimization to maximize the yield of correctly folded, functional protein while minimizing aggregation or inclusion body formation.

Catalytic Mechanism and Substrate Specificity

Lipoprotein signal peptidases function through a distinctive catalytic mechanism involving the recognition of specific sequence motifs within prolipoproteins following their initial lipid modification. The enzyme cleaves the signal peptide at a conserved recognition site, typically characterized by a lipobox motif, releasing the mature lipoprotein for incorporation into its target membrane environment. In Cyanothece sp., the lspA enzyme likely recognizes similar substrate determinants as those established for other bacterial lipoprotein signal peptidases, including Synechocystis sp. lspA. The specific substrate repertoire of Cyanothece sp. lspA would be expected to include various membrane-associated lipoproteins involved in photosynthesis, respiration, and potentially nitrogen fixation, though the complete substrate profile remains to be experimentally determined. The catalytic activity of recombinant lspA can be assessed through various biochemical assays, including in vitro processing of synthetic peptide substrates or natural prolipoprotein substrates isolated from Cyanothece sp. or expressed recombinantly.

Coordination with Photosynthesis and Nitrogen Fixation

The metabolic versatility of Cyanothece sp., particularly its capacity for both oxygenic photosynthesis and nitrogen fixation, suggests potential integration of lipoprotein processing within the broader temporal organization of these antagonistic processes. During the day-night cycle, Cyanothece cells undergo substantial remodeling of their metabolic machinery, with distinct transcriptional programs activated during photosynthetic and nitrogen-fixing phases . The processing of membrane proteins by lspA may be coordinated with these metabolic transitions to ensure proper assembly and function of membrane complexes supporting these divergent physiological states. The analysis of global transcriptomic data from Cyanothece 51142 reveals that approximately 30% of genes exhibit robust oscillating expression profiles throughout the diurnal cycle, including those involved in central metabolic pathways . Although specific data on lspA expression patterns within this cycle are not directly provided in the available literature, it is reasonable to hypothesize that its activity might be regulated in concert with the broader rhythmic changes in cellular metabolism and membrane organization.

Membrane Dynamics and Protein Trafficking

The spatial organization of photosynthetic and respiratory complexes within the membrane systems of Cyanothece sp. represents another dimension where lipoprotein signal peptidase activity may play a significant role. Unlike Synechococcus sp. PCC 7942, which displays radial asymmetry in the distribution of photosynthetic complexes, Cyanothece sp. exhibits a more uniform distribution of photosystems throughout its thylakoid membranes . This structural arrangement, characterized by thylakoids protruding radially from several poles along the cytoplasmic membrane, likely necessitates specific mechanisms for targeting and incorporating lipoproteins into appropriate membrane compartments. The lspA enzyme would contribute to this process by ensuring proper maturation of lipoproteins destined for various membrane locations, potentially with different processing kinetics or regulatory mechanisms depending on the cellular context and metabolic state. The coordination of lipoprotein processing with membrane dynamics may be particularly important during the transitions between photosynthetic and nitrogen-fixing states, when significant reorganization of membrane protein complexes likely occurs.

Enzyme Engineering and Biocatalytic Applications

The recombinant production of Cyanothece sp. lspA offers promising avenues for enzyme engineering and biocatalytic applications. The unique properties of this enzyme, particularly its potential adaptation to the distinctive metabolic cycles of Cyanothece sp., may confer advantages for certain biotechnological processes requiring controlled processing of lipoproteins or membrane-associated peptides. Through protein engineering approaches, including directed evolution or rational design strategies, the substrate specificity and catalytic efficiency of recombinant lspA could be tailored for specific industrial or pharmaceutical applications. These might include the production of bioactive lipopeptides, development of membrane protein display technologies, or creation of novel biosensors based on lipoprotein processing. The optimization of expression systems for high-yield production of functional recombinant lspA represents an important technical objective that would facilitate broader exploration of these potential applications.

Future Research Directions

The current understanding of Cyanothece sp. lspA presents several compelling directions for future research. First, comprehensive characterization of the native enzyme from Cyanothece sp. would provide crucial insights into its specific structural features, substrate preferences, and regulatory mechanisms. Second, investigation of its expression patterns throughout the diurnal cycle would elucidate how lipoprotein processing is integrated with the broader metabolic transitions between photosynthesis and nitrogen fixation. Third, systematic identification of its natural substrates in Cyanothece sp. would illuminate its functional role in supporting various cellular processes, potentially revealing novel aspects of membrane protein biogenesis in diazotrophic cyanobacteria. Fourth, comparative analysis with lspA enzymes from other cyanobacterial species could uncover evolutionary adaptations associated with different photosynthetic lifestyles and environmental niches. Finally, exploration of its potential applications in synthetic biology and biotechnology would expand the practical significance of this enzyme beyond its natural biological context.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
lspA; PCC7424_4973; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Cyanothece sp. (strain PCC 7424) (Synechococcus sp. (strain ATCC 29155))
Target Names
lspA
Target Protein Sequence
MMKKNRWFWLVAIIGLGLDQLTKYITVQSFETIGDTFGLWPGVFHLTYVINTGAAFSFFK GGAVWLRWLSLAVSLGLIFLGWYAPRMRIVEQLGYGFILAGALGNGIDRFLFGYVVDFLD FRLINFPVFNLADTFINIGIFFLLLASFPPKSSSQKNTSQ
Uniprot No.

Target Background

Function
This protein is specifically designed to catalyze the removal of signal peptides from prolipoproteins.
Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Lipoprotein signal peptidase (LspA) and what is its functional role?

Lipoprotein signal peptidase (LspA) is an aspartyl protease that performs the second step in the lipoprotein processing pathway by cleaving the transmembrane helix signal peptide of lipoproteins . LspA works sequentially after prolipoprotein diacylglyceryl transferase (Lgt), which first anchors prolipoproteins into the cell membrane through diacylglycerol. LspA then generates the mature lipoprotein by removing the signal peptide . This processing is crucial for proper lipoprotein maturation and functionality in bacterial cells.

The LspA enzyme is highly conserved across bacterial species, indicating its evolutionary importance. While it is considered essential in Gram-negative bacteria, it is not essential but contributes significantly to virulence in Gram-positive bacteria such as Staphylococcus aureus .

Why is Cyanothece sp. ATCC 51142 significant in LspA research?

Cyanothece sp. ATCC 51142 is a diazotrophic cyanobacterium notable for its ability to perform oxygenic photosynthesis . This organism has been extensively studied for its unique metabolic capabilities, including its diurnal regulation of various cellular processes. The genome of Cyanothece 51142 contains 5,304 protein-encoding ORFs, of which approximately 68.2% have been detected at the protein level .

Cyanothece sp. has gained attention in recombinant protein research due to its well-characterized genome and protein expression patterns. Its protein components, including LspA, have been successfully expressed in other bacterial systems like Synechococcus elongatus PCC 7942, demonstrating the feasibility of heterologous expression of Cyanothece proteins .

What are the key structural elements of LspA that contribute to its catalytic function?

LspA contains several critical structural elements that facilitate its function as a membrane-bound aspartyl protease:

  • Catalytic Diad: LspA contains a catalytic diad of aspartate residues that are essential for its protease activity .

  • β-cradle Structure: This structural element helps form the active site where substrate binding occurs .

  • Periplasmic Helix (PH): This flexible region undergoes conformational changes that are critical for substrate binding and catalysis .

The active site of LspA is adaptable, allowing it to accommodate various lipoprotein substrates. Molecular dynamics simulations and EPR studies have revealed that the enzyme adopts multiple conformations, with the periplasmic helix functioning as a "clamp" that can open and close to control access to the active site .

How does LspA's conformational dynamics affect its function and substrate binding?

LspA exhibits significant conformational dynamics that are crucial for its function. Research using molecular dynamics (MD) simulations and electron paramagnetic resonance (EPR) has revealed that:

  • In the apo (unbound) state, the periplasmic helix fluctuates on the nanosecond timescale and predominantly adopts a closed conformation that occludes the charged active site from the lipid bilayer .

  • When bound to antibiotics like globomycin, the periplasmic helix adopts a more open conformation, with multiple possible binding modes .

  • LspA samples at least three distinct conformations: closed, intermediate, and open. The open conformation is the only one that would sterically allow prolipoprotein substrate to enter and bind in the active site for signal peptide cleavage .

These conformational states explain LspA's ability to process a variety of lipoprotein substrates despite having a single active site. The flexibility and adaptability of the periplasmic helix and active site region are essential for accommodating different substrate molecules.

What expression systems are most effective for recombinant production of Cyanothece sp. LspA?

For recombinant production of Cyanothece sp. LspA, several expression systems have proven effective:

  • Heterologous expression in cyanobacteria: Synechococcus elongatus PCC 7942 has been successfully used to express Cyanothece sp. proteins. Researchers have generated transformants that constitutively express distinct protein variations, including those from Cyanothece sp. ATCC 51142 .

  • Expression with signal peptides: When expressing membrane proteins like LspA, inclusion of appropriate signal peptides is crucial. For instance, researchers have used constructs with the protein's native signal peptide (L Cya-EcaA Cya) to ensure proper localization .

The choice of expression system should consider factors such as proper protein folding, post-translational modifications, and cellular localization. For membrane proteins like LspA, expression systems that facilitate proper membrane insertion are particularly important.

What purification challenges are specific to LspA as a membrane protein?

Purifying recombinant LspA presents several challenges due to its nature as a membrane protein:

  • Membrane extraction: LspA must be carefully extracted from bacterial membranes using detergents that maintain its native structure and activity.

  • Protein stability: As a membrane protein, LspA may have reduced stability when removed from its native lipid environment.

  • Conformational heterogeneity: As demonstrated by molecular dynamics studies, LspA samples multiple conformations, which can complicate structural and functional analyses .

To address these challenges, researchers often employ techniques such as:

  • Detergent screening to identify optimal solubilization conditions

  • Use of membrane mimetics (like nanodiscs or liposomes) for functional studies

  • Protein stabilization strategies, including the use of ligands or inhibitors like globomycin

How does LspA contribute to bacterial resistance mechanisms?

LspA plays a significant role in bacterial resistance to both host defense molecules and antibiotics:

  • Resistance to host defense molecules: LspA has been identified as a resistance determinant against human group IIA-secreted phospholipase A₂ (hGIIA), a potent host defense molecule. Deletion or inhibition of LspA increases bacterial susceptibility to hGIIA-mediated killing .

  • Antibiotic resistance: LspA contributes to resistance against daptomycin, a last-resort antibiotic used to treat MRSA infections. Inhibition of LspA with compounds like globomycin or myxovirescin A1 sensitizes bacteria to daptomycin .

  • Role in lipoprotein maturation: Many lipoproteins processed by LspA are involved in antibiotic resistance mechanisms, including beta-lactamase BlaZ and Dsp1 .

The high conservation of LspA across bacterial species (analysis of >26,000 S. aureus genomes showed that LspA is highly sequence-conserved) suggests that targeting this enzyme could have broad-spectrum applications against various bacterial pathogens .

How can recombinant LspA be utilized in antibiotic development research?

Recombinant LspA serves as a valuable tool in antibiotic development research:

  • Target validation: Recombinant LspA can be used in biochemical and structural studies to validate its potential as an antibiotic target.

  • Inhibitor screening: Purified recombinant LspA facilitates high-throughput screening of potential inhibitors.

  • Structure-based drug design: Structural studies of LspA, especially its conformational dynamics in different states (apo and inhibitor-bound), provide crucial insights for rational drug design .

  • Combination therapy development: Understanding how LspA inhibition sensitizes bacteria to existing antibiotics like daptomycin can lead to the development of effective combination therapies .

Research has demonstrated that pharmacological interference with LspA may disarm Gram-positive pathogens, including MRSA, enhancing their clearance by both innate host defense molecules and clinically applied antibiotics .

What techniques are most effective for studying LspA conformational dynamics?

Several complementary techniques have proven effective for investigating LspA conformational dynamics:

  • Molecular Dynamics (MD) Simulations: MD simulations using systems like GROMACS with appropriate force fields (e.g., Martini 2.2) allow for detailed analysis of protein movements in membrane environments .

  • Electron Paramagnetic Resonance (EPR): Both continuous wave (CW) and Double Electron-Electron Resonance (DEER) EPR methods provide experimental validation of conformational states predicted by simulations .

  • X-ray Crystallography: Crystal structures provide high-resolution snapshots of different LspA conformational states, particularly when bound to inhibitors like globomycin .

The most comprehensive understanding comes from combining these approaches. For example, researchers have used MD simulations to generate ensembles of conformations, then validated these with experimental EPR restraints to identify physiologically relevant states .

How can site-directed mutagenesis be applied to study LspA function?

Site-directed mutagenesis is a powerful approach for investigating LspA structure-function relationships:

  • Catalytic residue mutations: Mutating the catalytic aspartate residues can confirm their role in enzymatic activity.

  • Periplasmic helix modifications: Introducing mutations in the periplasmic helix region can alter its flexibility and conformational dynamics, providing insights into its role in substrate binding and catalysis .

  • Substrate selectivity determinants: Mutational analysis can identify residues that contribute to substrate recognition and binding.

  • Inhibitor binding site mapping: Mutations that affect inhibitor binding but not catalytic activity can help map the inhibitor binding pocket.

What are common challenges in heterologous expression of Cyanothece proteins in other bacterial systems?

Heterologous expression of Cyanothece proteins, including LspA, in other bacterial systems presents several challenges:

  • Codon usage differences: Cyanobacteria have distinct codon usage patterns that may require optimization for efficient expression in other hosts.

  • Protein targeting and localization: Proper localization of membrane proteins like LspA requires appropriate signal sequences. As seen in the research with Synechococcus transformants, the choice of signal peptide is crucial for proper protein localization and function .

  • Functional differences: Even when successfully expressed, proteins may not function identically in heterologous hosts. For example, when EcaA from Cyanothece was expressed in Synechococcus, it had no discernible effect under most conditions and even disadvantaged the host under certain conditions (Na+ depletion, reduction in CO2) .

  • Host regulatory mechanisms: Host organisms may have mechanisms that limit the expression or activity of foreign proteins. For instance, Synechococcus appears to have mechanisms that limit the appearance of certain proteins in the periplasm .

How can researchers verify the proper folding and activity of recombinant LspA?

Verifying proper folding and activity of recombinant LspA is essential for ensuring experimental validity:

Researchers working with Synechococcus transformants have confirmed the presence of recombinant proteins in the soluble protein fraction (enriched in cytoplasmic and periplasmic proteins) and verified their activity, demonstrating the feasibility of these approaches .

How should researchers interpret conflicting data on LspA conformational states?

When faced with conflicting data regarding LspA conformational states, researchers should consider several factors:

  • Experimental conditions: Different membrane mimetics, detergents, or buffer conditions can affect protein conformation. For example, molecular dynamics simulations suggest LspA samples three conformations (closed, intermediate, and open), but experimental DEER data may not detect all of these if certain conformations are unstable in the chosen membrane mimic .

  • Timescale of measurements: Some techniques capture rapid conformational changes (nanosecond timescale) that other methods might miss. MD simulations have shown that the periplasmic helix of LspA fluctuates on the nanosecond timescale .

  • Population distributions: A two-component CW line shape and multiple distance populations observed in experimental data suggest that LspA samples multiple conformations in all states (apo, globomycin-bound, and myxovirescin-bound), but the population distributions vary in each state .

  • Functional relevance: Consider which conformational state would be functionally relevant. For example, the open conformation is the only one that would allow prolipoprotein substrate to enter the active site, even if it represents a minor population in experimental data .

What statistical approaches are appropriate for analyzing LspA conformational ensemble data?

When analyzing conformational ensemble data for LspA, several statistical approaches are appropriate:

  • Principal Component Analysis (PCA): To identify the major modes of motion and reduce the dimensionality of conformational data from MD simulations.

  • Cluster Analysis: To group similar conformations and identify representative structures from large simulation datasets.

  • Markov State Models (MSMs): To analyze transitions between different conformational states and estimate their relative populations and interconversion rates.

  • Ensemble Refinement: Using experimental restraints (like those from EPR) to select or weight conformations from MD simulations that best match experimental observations .

  • Bootstrap Analysis: To estimate the statistical uncertainty in derived parameters from experimental data, such as distance distributions from DEER experiments.

When applying these methods, researchers should be mindful of potential biases in their simulations or experiments and validate their findings using multiple, complementary approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.