Recombinant Cyanothece sp. NAD (P)H-quinone oxidoreductase subunit 3
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us, and we will prioritize its development.
If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
ndhC; cce_1764; NAD(PH-quinone oxidoreductase subunit 3; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3; NDH-1 subunit 3; NDH-C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Cyanothece sp. (strain ATCC 51142)
Target Names
ndhC
Target Protein Sequence
MFVLNGYEYVLGFLLACSLIPILALTASKILRPSGGGPERRTTYESGMEPIGGAWIQFNI
RYYMFALVFVVFDVETVFLYPWAVAFSRLGLLAFVEALIFIAILVVALVYAWRKGALEWS
Uniprot No.
Target Background
Function
NDH-1 (NAD(P)H-quinone oxidoreductase subunit 3) functions as an electron shuttle, transferring electrons from an unidentified donor, via FMN and iron-sulfur (Fe-S) clusters, to quinones within the respiratory and/or photosynthetic chain. In this organism, plastoquinone is believed to be the immediate electron acceptor. This redox reaction is coupled to proton translocation, conserving energy as a proton gradient. In cyanobacteria, NDH-1 additionally participates in inorganic carbon concentration.
Database Links
KEGG: cyt:cce_1764
STRING: 43989.cce_1764
Protein Families
Complex I subunit 3 family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
