Recombinant Cyanothece sp. Photosystem I assembly protein Ycf4 (ycf4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
ycf4; PCC8801_0542; Photosystem I assembly protein Ycf4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Cyanothece sp. (strain PCC 8801) (Synechococcus sp. (strain PCC 8801 / RF-1))
Target Names
ycf4
Target Protein Sequence
MNAPAMTSDRLVLREEVLGSRRFSNIWWGTVAAIGGIGFLLAGLSSYLRVNLLIVSDTSQ LVFIPQGIALLFYGIAGSALSLYLWFTIILDIGGGYNEFNKETGKVTIFRWGFPGKNRRI EVSYPLADIQAIRADIKEGLNTKRKLYIQLKQRREIPLTRVGRPISLSELENQGAELARF LGVPLEGL
Uniprot No.

Target Background

Function

This protein appears essential for the assembly of the photosystem I complex.

Database Links
Protein Families
Ycf4 family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the Functional Role of Ycf4 in Photosystem I Assembly?

Ycf4 (hypothetical chloroplast reading frame no. 4) functions as an essential assembly factor for photosystem I (PSI) in many photosynthetic organisms. In Chlamydomonas reinhardtii, Ycf4 is critical for PSI complex formation, with ycf4-deficient mutants unable to grow photoautotrophically due to their inability to accumulate the PSI complex . The protein is part of a large complex (>1500 kD) containing newly synthesized PSI polypeptides that likely represents an assembly intermediate of PSI . Mechanistically, Ycf4 assists in the stepwise assembly of the PSI reaction center, functioning between Ycf3 (which helps with initial assembly of newly synthesized PsaA/B subunits) and the peripheral PSI subunits . This function appears to be conserved across photosynthetic organisms, though its essentiality varies between species.

How Does the Role of Ycf4 Differ Between Cyanobacteria, Green Algae, and Higher Plants?

The function of Ycf4 shows significant evolutionary differences across photosynthetic organisms:

OrganismEssentialityPSI AccumulationPhenotype in ycf4 Mutants
Cyanobacteria (Synechocystis)Non-essentialReduced but presentAble to grow photoautotrophically with altered pigment composition
Green algae (C. reinhardtii)EssentialAlmost completely absentUnable to grow photoautotrophically
Higher plants (Tobacco)Non-essentialReducedSeverely affected photosynthesis but still capable of photoautotrophic growth under low light conditions

These differences suggest that while the fundamental role of Ycf4 in PSI assembly is conserved, higher plants have potentially evolved alternative mechanisms or redundant systems for PSI assembly. Additionally, C. reinhardtii appears to possess a chloroplast "clearing system" that degrades misassembled protein complexes more efficiently than cyanobacteria, potentially explaining the more severe phenotype in algal ycf4 mutants .

What Methods Are Most Effective for Purifying Recombinant Ycf4 for Functional Studies?

For the purification of Ycf4-containing complexes, tandem affinity purification (TAP) has proven highly effective. This approach involves:

  • Generation of TAP-tagged Ycf4 constructs with calmodulin binding peptide and Protein A domains separated by a tobacco etch virus protease cleavage site

  • Two-step affinity column chromatography for high-purity isolation

  • Subsequent purification steps including sucrose gradient ultracentrifugation and ion exchange column chromatography

For recombinant Ycf4 protein production, expression systems using mammalian cells have been successfully employed to produce >85% pure protein (as determined by SDS-PAGE) . The recombinant protein is typically stored in Tris-based buffer with 50% glycerol at -20°C for short-term or -80°C for long-term storage. Working aliquots should be maintained at 4°C for up to one week to avoid repeated freeze-thaw cycles which can compromise protein integrity .

How Do the Amino and Carboxyl Termini of Ycf4 Differ in Their Interactions with Photosynthetic Proteins?

The amino and carboxyl termini of Ycf4 exhibit distinct interaction patterns with photosynthetic proteins:

Protein PartnerAmino Terminus InteractionCarboxyl Terminus InteractionFunctional Implication
PsaB (PS-I)Strong (5 hydrogen bonds)WeakerAmino terminus may be critical for initial PSI assembly
PsaH (PS-I)WeakerStrong (12 hydrogen bonds)Carboxyl terminus likely stabilizes mature PSI complexes
PsbC (PS-II)WeakerStrong (13 hydrogen bonds)Suggests potential secondary role in PSII organization
ATP synthase (atpB)Weak (8 hydrogen bonds)Very strong (28 hydrogen bonds)Carboxyl terminus may coordinate PSI assembly with ATP production

In-silico docking studies have consistently demonstrated that the carboxyl terminus of Ycf4 forms stronger interactions with most photosynthetic proteins compared to the amino terminus. This suggests that while the amino terminus may be involved in initial recognition and binding events, the carboxyl terminus is more crucial for stabilizing protein-protein interactions during PSI assembly .

What Experimental Approaches Can Be Used to Study Ycf4 Function in Photosystem I Assembly?

Several complementary experimental approaches have proven valuable for understanding Ycf4 function:

  • Reverse Genetics:

    • Generation of ycf4 knockout mutants through biolistic transformation of chloroplast genomes

    • Analysis of photosynthetic performance, PSI accumulation, and photoautotrophic growth

  • Biochemical Characterization:

    • Affinity purification of Ycf4-containing complexes

    • Mass spectrometry (liquid chromatography-tandem MS) to identify interacting partners

    • Immunoblotting to confirm protein associations and quantify protein levels

  • Structural Analysis:

    • Electron microscopy and single particle analysis to visualize Ycf4-containing complexes

    • In-silico protein docking to predict interaction interfaces

  • Dynamics Studies:

    • Pulse-chase protein labeling to determine if Ycf4 associates with newly synthesized PSI polypeptides

    • Analysis of assembly intermediates to establish the temporal sequence of PSI biogenesis

  • Heterologous Expression:

    • Expression of ycf4 in model organisms to test functional complementation

    • Examination of Ycf4 function in different genetic backgrounds

How Do Ycf4 and Ycf3 Cooperate in the Assembly of Photosystem I?

Ycf4 and Ycf3 work together in a coordinated manner during PSI assembly:

  • Sequential Action:

    • Ycf3 assists in the initial assembly of newly synthesized PsaA/B subunits into a reaction center subcomplex

    • Ycf4 functions downstream of Ycf3, stabilizing the RC subcomplex until peripheral subunits can associate

  • Co-Transcription:

    • In C. reinhardtii, ycf4 and ycf3 are co-transcribed as members of the rps9-ycf4-ycf3-rps18 polycistronic transcriptional unit

    • This suggests coordinated expression and potentially coordinated function

  • Similar Phenotypes:

    • Knockout mutants of either gene in C. reinhardtii result in similar phenotypes: inability to grow photoautotrophically and deficiency in PSI activity

    • Both proteins are membrane-associated but not stably associated with the mature PSI complex

  • Distinct Molecular Interactions:

    • Ycf3 works with Y3IP1/CGL59 to transfer the RC subcomplex to the Ycf4 module

    • Ycf4 forms a module that stabilizes the RC subcomplex during assembly

Research suggests that while both proteins are necessary for PSI assembly, they perform distinct but complementary functions, with Ycf3 acting earlier in the assembly process and Ycf4 functioning as a stabilizing scaffold during intermediate stages of assembly.

What Light-Dependent Processes Affect Ycf4 Function in Relation to Chlorophyll Synthesis?

Light plays a critical role in processes related to PSI assembly where Ycf4 functions:

  • Light Requirements for Complementary Processes:

    • Research shows that chlorophyll f synthesis, which is important for far-red light photoacclimation (FaRLiP), requires light for activity

    • In experiments with Synechococcus 7002 expressing chlF/psbA4, cells maintained in far-red light or low-intensity white light synthesized chlorophyll f, while cells in darkness did not

  • Effect on Assembly Dynamics:

    • Light conditions alter the rate of PSI assembly and turnover

    • Under high light conditions, photo-oxidative damage to assembly intermediates may increase the requirement for Ycf4 protection

  • Light Quality Considerations:

    • Far-red light (FRL) enriched environments induce the FaRLiP response, which involves extensive remodeling of PSI and PSII

    • This remodeling likely requires altered activity of assembly factors including Ycf4

  • Experimental Evidence:

    • In Chlorogloeopsis fritschii PCC 9212, cells grown in FRL continuously synthesized chlorophyll f (detectable by 740-nm fluorescence emission)

    • When placed in darkness, chlorophyll f synthesis stopped but resumed when cells were returned to FRL

Understanding these light-dependent processes is critical for correctly interpreting experimental results involving Ycf4 and designing appropriate growth conditions for functional studies.

What Analytical Methods Are Most Suitable for Detecting Ycf4-Protein Interactions in Assembly Intermediates?

Several analytical approaches have proven effective for studying Ycf4-protein interactions:

  • Mass Spectrometry-Based Approaches:

    • Liquid chromatography-tandem mass spectrometry (LC-MS/MS) has successfully identified PSI subunits (PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF) and COP2 in Ycf4-containing complexes

    • This approach requires careful sample preparation to maintain complex integrity

  • Immunological Methods:

    • Immunoblotting using antibodies against suspected interaction partners is valuable for confirming mass spectrometry results

    • Western blot analysis can reveal whether PSI subunits accumulate stably in thylakoid membranes of ycf4 mutants

  • Biophysical Techniques:

    • Sucrose gradient ultracentrifugation effectively separates large protein complexes

    • Ion exchange column chromatography can further purify complexes based on their charge properties

  • Visualization Methods:

    • Transmission electron microscopy and single particle analysis can reveal the structural organization of Ycf4-containing complexes

    • These techniques have shown that Ycf4-containing complexes can form large structures measuring approximately 285 × 185 Å

  • Dynamic Interaction Studies:

    • Pulse-chase protein labeling can demonstrate that PSI polypeptides associated with Ycf4-containing complexes are newly synthesized and partially assembled

    • This approach helps distinguish assembly intermediates from mature complexes

How Does the Structure-Function Relationship of Ycf4 Inform Its Role in PSI Assembly?

The structure-function relationship of Ycf4 provides key insights into its assembly role:

What Experimental Conditions Should Be Considered When Working with Recombinant Ycf4 Protein?

When working with recombinant Ycf4 protein, several critical experimental conditions should be considered:

  • Storage Conditions:

    • Store at -20°C for short-term or -80°C for long-term stability

    • Use 50% glycerol as a cryoprotectant in storage buffer

    • Maintain working aliquots at 4°C for up to one week to prevent degradation from repeated freeze-thaw cycles

  • Buffer Composition:

    • Tris-based buffers optimized for protein stability work well for Ycf4

    • The specific buffer composition may need optimization depending on the experimental application

  • Light Conditions:

    • Consider the light dependency of PSI assembly processes when designing experiments

    • Control light conditions (intensity, quality, and photoperiod) carefully during functional assays

  • Reconstitution Protocols:

    • Centrifuge vials briefly before opening to bring contents to the bottom

    • Reconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL

    • Add 5-50% glycerol (final concentration) for storage stability

  • Purity Considerations:

    • Commercial preparations typically achieve >85% purity as determined by SDS-PAGE

    • Higher purity may be required for certain structural or functional studies

  • Experimental Controls:

    • Include appropriate controls for both positive function (native Ycf4 preparations) and negative controls (denatured protein or buffer-only conditions)

    • Consider including related proteins (such as Ycf3) as specificity controls in interaction studies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.