Recombinant Cyanothece sp. Photosystem I reaction center subunit XI (psaL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
psaL; cce_3964; Photosystem I reaction center subunit XI; PSI subunit V; PSI-L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Cyanothece sp. (strain ATCC 51142)
Target Names
psaL
Target Protein Sequence
MDIIGQRGDPQIGNLATPVNSSRLSLAFIRNLPAYRRGLSANRRGLEVGMAHGYFLYGPF AILGPLRNTEYASTGGLLSAVAMISILTIALSLYASVEVGKPIETLTTPDVPEDLGTSVG WGEFANGFFIGGSGGVIFAYLLCQALYFDLIQKILG
Uniprot No.

Target Background

Database Links
Protein Families
PsaL family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the PsaL protein and what role does it play in cyanobacterial photosystems?

PsaL is the Photosystem I reaction center subunit XI, a protein component essential for the formation and stabilization of PSI trimers in cyanobacteria. The presence of PsaL is specifically required for trimer formation or stabilization in photosynthetic complexes. Research with mutant strains lacking PsaL has demonstrated that only monomeric PSI complexes can be isolated when using Triton X-100 to solubilize thylakoid membranes, while wild-type strains typically maintain trimeric PSI complexes . PsaL also participates in state transitions between different photosynthetic states, with evidence suggesting that PSI complexes containing PsaL may be mobile within the thylakoid membrane during these physiological adaptations .

How is the psaL gene organized in cyanobacteria?

The gene organization of psaL varies among cyanobacterial species. In Synechococcus sp. strain PCC 7002, psaI occurs upstream and is divergently transcribed from the psaL gene, a configuration that differs from other studied cyanobacteria . This diverse gene organization suggests evolutionary adaptation in different cyanobacterial lineages. Understanding the genomic context of psaL is important for genetic manipulation and expression studies, particularly when designing recombinant constructs targeting this gene.

How does PsaL contribute to the oligomeric state of Photosystem I in different cyanobacterial species?

PsaL plays a critical role in determining the oligomeric state of PSI complexes across cyanobacterial species. Biochemical analyses of mutant PSI complexes indicate that PsaL is essential for trimer formation or stabilization. In mutant studies, approximately 10% of PSI complexes from psaI mutants could be isolated as trimers when using n-dodecyl β-D-maltoside for membrane solubilization, whereas no trimers could be isolated from psaL mutants under the same conditions . These findings suggest that while PsaL is absolutely required for trimer formation, PsaI contributes to stabilizing the interaction between PsaL and other PSI components like PsaM.

The functional significance of PSI trimerization likely relates to optimizing light-harvesting capabilities under varying environmental conditions. Researchers investigating this aspect should consider analyzing the molecular interactions at subunit interfaces using techniques such as cryo-electron microscopy or chemical cross-linking coupled with mass spectrometry to identify precise interaction domains between PsaL and other PSI subunits.

What is the relationship between photosynthetic activity and recombinant protein production in engineered cyanobacteria?

RNA-seq analysis of recombinant Synechocystis sp. has revealed a fascinating correlation between enhanced photosynthetic activity and higher production of heterologous proteins. Strains engineered for increased polyhydroxyalkanoate (PHA) synthesis showed significant upregulation of genes encoding proteins involved in photosynthesis, including photosystem I and II components, cytochrome complexes, and chlorophyll metabolism .

How does the small regulatory RNA PsrR1 control psaL expression in cyanobacteria?

The small noncoding RNA PsrR1 (previously known as SyR1) has been identified as a key posttranscriptional regulator of photosynthetic gene expression in Synechocystis sp. PCC 6803. PsrR1 is induced shortly after a shift from moderate to high-light conditions and directly targets several photosynthesis-related mRNAs, including psaL .

Molecular studies have demonstrated that PsrR1 interacts with the ribosome binding regions of psaL mRNA, affecting its translation and stability. Importantly, the psaL mRNA is processed by RNase E only in the presence of PsrR1, suggesting a mechanism where the small RNA mediates target degradation through recruitment of ribonucleases . This regulatory relationship provides a molecular basis for light-dependent control of PSI composition. Researchers working with recombinant PsaL expression should consider the potential impact of this regulatory RNA, especially when designing expression constructs and selecting environmental conditions for cultivation.

What genetic tools are available for engineering Cyanothece sp. for recombinant PsaL studies?

Several genetic manipulation tools have been developed for cyanobacteria that can be applied to Cyanothece sp. for PsaL studies. A notable system involves conjugative transfer protocols using RSF1010-derived replicative plasmids, which have been successfully employed in Cyanothece PCC 7425 . This system utilizes plasmid vectors such as pSB2A and pFC1 that can be transferred from E. coli to cyanobacteria and stably maintained as autonomously replicating elements.

The conjugation protocol developed for Cyanothece PCC 7425 involves co-incubation of the cyanobacterial recipient strain with two E. coli strains on solid media: one harboring the RP4 plasmid (providing transfer functions) and another containing the RSF1010-derived vector carrying the gene of interest . This approach yields conjugation frequencies of approximately 5×10^-4 per cyanobacterial cell . The transferred plasmids can be used for:

  • Promoter analysis

  • High-level constitutive or temperature-controlled protein production

  • Analysis of sub-cellular protein localization

These tools provide a robust foundation for recombinant PsaL expression and functional studies in Cyanothece species.

What approaches are most effective for analyzing PsaL-dependent PSI trimerization?

Investigating PsaL-dependent PSI trimerization requires a combination of biochemical, biophysical, and structural techniques:

  • Membrane solubilization optimization: Different detergents yield varying results when isolating PSI complexes. While Triton X-100 extraction yields only monomeric PSI complexes from psaL mutants, n-dodecyl β-D-maltoside preserves some trimeric structures in psaI mutants but not in psaL mutants .

  • Sucrose density gradient ultracentrifugation: This technique effectively separates PSI monomers from trimers based on their sedimentation properties.

  • Blue-native PAGE: Provides a complementary approach for analyzing the oligomeric state of membrane protein complexes.

  • Subunit composition analysis: Mass spectrometry-based proteomic analysis of isolated PSI complexes can reveal which subunits are present or depleted in different oligomeric forms.

  • Functional spectroscopy: Techniques such as low-temperature (77K) fluorescence spectroscopy can assess the functional properties of different PSI oligomeric states.

When designing experiments to study PsaL-dependent trimerization, researchers should carefully consider these methodological aspects to obtain reliable and interpretable results.

How can transcriptional and post-transcriptional regulation of psaL be assessed in cyanobacteria?

Studying the regulation of psaL expression requires methods that can distinguish between transcriptional and post-transcriptional mechanisms:

  • RNA-seq analysis: Provides comprehensive transcriptome data to identify changes in psaL expression under different conditions. In recombinant strains with enhanced photosynthetic capacity, RNA-seq has revealed significant upregulation of photosystem components .

  • Small RNA targeting analysis: Computational prediction tools combined with experimental validation can identify small RNAs like PsrR1 that target psaL mRNA. Confirming these interactions requires techniques such as:

    • Mutational analysis in heterologous reporter systems

    • In vitro RNA binding assays

    • RNase protection assays

  • mRNA stability assessment: The degradation of psaL mRNA in the presence of regulatory factors like PsrR1 can be monitored using transcription inhibition followed by quantitative RT-PCR or northern blot analysis.

  • RNase E dependency tests: Since psaL mRNA processing involves RNase E in the presence of PsrR1, studies with RNase E-deficient strains or temperature-sensitive mutants can illuminate this regulatory mechanism .

These methodologies provide a comprehensive toolkit for dissecting the complex regulation of psaL expression in cyanobacteria.

What strategies can improve recombinant PsaL expression and incorporation into functional PSI complexes?

Optimizing recombinant PsaL expression and assembly into functional PSI complexes requires consideration of several factors:

  • Promoter selection: Utilizing strong, inducible promoters can provide controlled expression of recombinant PsaL. The RSF1010-derived plasmid vector pSB2A has been successfully used for promoter analysis in Cyanothece PCC 7425 .

  • Codon optimization: Adjusting the codon usage of the psaL gene to match the host's preferred codons can improve translation efficiency.

  • Expression timing: Coordinating PsaL expression with other PSI subunits is crucial for proper complex assembly. Temperature-controlled expression systems available for cyanobacteria can facilitate this synchronization .

  • Sub-cellular localization targeting: Adding appropriate transit peptides or utilizing native targeting sequences ensures proper localization of recombinant PsaL to thylakoid membranes where PSI assembly occurs.

  • Growth condition optimization: As photosynthetic activity correlates with recombinant protein production in cyanobacteria, optimizing light intensity, nutrient availability, and cultivation temperature can enhance PsaL expression and assembly .

Researchers should monitor both PsaL expression levels and functional incorporation into PSI complexes using techniques such as immunoblotting, blue-native PAGE, and photosynthetic activity measurements.

How should experiments be designed to investigate the interaction between PsaL and the regulatory RNA PsrR1?

To effectively study PsaL-PsrR1 interactions, researchers should implement a multi-faceted experimental approach:

  • Mutational analysis of interaction sites: Systematically altering predicted binding regions in both psaL mRNA and PsrR1 can confirm direct interactions. This approach has been successfully used to validate interactions between PsrR1 and the ribosome binding regions of psaL mRNA .

  • Expression correlation studies: Monitoring PsaL protein levels and PsrR1 RNA abundance under varying environmental conditions (especially different light intensities) can reveal physiologically relevant regulatory relationships.

  • RNA immunoprecipitation: Identifying PsrR1-associated proteins and target mRNAs in vivo can provide insights into the complete regulatory network.

  • In vitro binding assays: Techniques such as electrophoretic mobility shift assays (EMSA) or surface plasmon resonance (SPR) can quantitatively characterize the binding affinity and kinetics between PsrR1 and psaL mRNA.

  • Functional readouts: Assessing PSI trimer formation and photosynthetic performance in strains with altered PsrR1 levels can connect molecular interactions to physiological outcomes.

This comprehensive approach enables researchers to elucidate both the molecular mechanisms and physiological significance of PsrR1-mediated regulation of psaL expression.

How can contradictory findings regarding PsaL function across different cyanobacterial species be reconciled?

When encountering apparently contradictory results regarding PsaL function across cyanobacterial species, researchers should consider:

  • Phylogenetic context: Different cyanobacterial lineages may have evolved distinct functional roles for PsaL. Comparative genomic analysis of psaL gene sequences and their genomic context can provide evolutionary insights.

  • Experimental conditions: Variations in growth conditions, light quality/quantity, and nutrient availability can dramatically affect PSI composition and function. Standardizing experimental conditions or explicitly testing condition-dependent effects is essential.

  • Methodological differences: Variation in membrane solubilization protocols significantly impacts PSI complex isolation. For example, studies have shown that different detergents (Triton X-100 versus n-dodecyl β-D-maltoside) yield different results regarding PSI trimers in psaI mutants .

  • Pleiotropy and compensation: Genetic modifications affecting psaL may trigger compensatory changes in other components of the photosynthetic apparatus. Systems biology approaches, including transcriptomics and proteomics, can help identify these secondary effects.

  • Functional redundancy: Some cyanobacteria may possess partially redundant mechanisms for functions typically attributed to PsaL. Comprehensive genetic analyses, including construction of multiple mutants, can reveal such redundancies.

Researchers should explicitly address these factors when designing experiments and interpreting results concerning PsaL function across different cyanobacterial species.

What statistical approaches are most appropriate for analyzing transcriptomic changes in psaL expression?

When analyzing transcriptomic data related to psaL expression, researchers should employ robust statistical methodologies:

  • Normalization methods: For RNA-seq data, normalization using metrics such as RPKM (Reads Per Kilobase of exon model per Million mapped reads) is essential for accurate comparison between samples. This approach has been successfully applied in studies of photosynthetic gene expression in recombinant Synechocystis sp. .

  • Differential expression analysis: Tools such as DESeq2 or edgeR can identify statistically significant changes in psaL expression across different conditions or genotypes.

  • Multiple testing correction: When analyzing expression changes across the entire transcriptome, corrections for multiple testing (e.g., Benjamini-Hochberg procedure) are necessary to control false discovery rates.

  • Biological replication: Ensuring adequate biological replication (minimum n=3) is critical for reliable statistical inference. High correlation coefficients between biological replicates (e.g., 0.96-0.98) indicate good reproducibility of sequencing data .

  • Pathway enrichment analysis: Beyond individual gene changes, analyzing functional categories of co-regulated genes can provide insights into broader physiological responses. In recombinant cyanobacteria, genes involved in photosynthesis, transport, and cell communication were significantly enriched among upregulated transcripts .

Proper statistical analysis ensures that observed changes in psaL expression are biologically meaningful rather than artifacts of experimental variation.

What emerging technologies might advance our understanding of PsaL function in cyanobacterial photosystems?

Several cutting-edge technologies hold promise for deepening our understanding of PsaL function:

  • Cryo-electron tomography: This technique can visualize native PSI complexes within intact thylakoid membranes, providing insights into the in vivo organization and dynamics of PsaL-containing complexes.

  • Single-molecule tracking: Advanced microscopy techniques allowing tracking of individual protein complexes in living cells could reveal the mobility and interactions of PSI complexes during state transitions, testing the "mobile-PSI" model proposed for PsaL function .

  • CRISPR-Cas9 genome editing: While traditional mutagenesis approaches have been valuable, precision genome editing would enable more subtle modifications to psaL, including point mutations that affect specific functions without completely eliminating the protein.

  • Synthetic biology approaches: Designing artificial photosystems with modified PsaL variants could help delineate structure-function relationships and potentially enhance photosynthetic efficiency.

  • Integrative multi-omics: Combining transcriptomics, proteomics, and metabolomics data can provide a systems-level understanding of how PsaL contributes to photosynthetic metabolism under various environmental conditions.

Researchers should consider incorporating these emerging technologies into their experimental designs to address longstanding questions about PsaL function that have been difficult to resolve with conventional approaches.

How might knowledge about PsaL regulation be applied to improve bioproduction in engineered cyanobacteria?

Understanding PsaL regulation offers several strategies for enhancing bioproduction in engineered cyanobacteria:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.