Recombinant Cyanothece sp. Photosystem II reaction center protein H (psbH)

Shipped with Ice Packs

In Stock

Cat. No.

BT2027481

Source

in vitro E.coli expression system

Synonyms

psbH; PCC8801_1645; Photosystem II reaction center protein H; PSII-H

Quick Inquiry

Description

Table 1: Comparative Properties of Recombinant PsbH Proteins

Property	Cyanidioschyzon merolae PsbH	Chaetosphaeridium globosum PsbH
Source Organism	Cyanidioschyzon merolae	Chaetosphaeridium globosum
Expression Host	E. coli	E. coli
Amino Acid Sequence	MALRTRLGEILRPLNSQYGKVAPGWGTTPIMGVFMVLF...	ATKTIDNSIKLKGRRSAVGDILKPLNSEYGKVAPGWGTT...
Length	64 residues	73 residues (mature protein)
Purity	>90% (SDS-PAGE)	>90% (SDS-PAGE)
Storage	-20°C/-80°C in Tris/PBS buffer	-20°C/-80°C in Tris/PBS buffer

While direct structural data for Cyanothece sp. PsbH is limited, homology modeling suggests a conserved α-helical domain (Thr36–Ser60) critical for membrane integration .

Functional Role in Photosystem II

PsbH stabilizes the PSII reaction center by:

Enhancing D1 Protein Assembly: PsbH interacts with the D1 protein (encoded by psbA), facilitating PSII repair under photoinhibitory conditions .
Modulating Electron Transport: In Cyanothece 51142, PSII activity peaks during nitrogenase-mediated H₂ production, correlating with increased psbA/psbD expression . Though PsbH dynamics are not explicitly detailed, its structural homology to Synechocystis PsbH implies analogous roles in maintaining PSII efficiency .

Biotechnological Relevance

Recombinant PsbH is used to study:

PSII Assembly Mechanisms: PsbH-deficient mutants show impaired PSII recovery after photodamage .
Stress Responses: In Synechocystis, PsbH expression increases under high-light stress, suggesting its role in photoprotection .

Technical Considerations

Expression Challenges: Cyanothece sp. PsbH may require codon optimization for E. coli due to genetic divergence .
Post-Translational Modifications: Native PsbH in cyanobacteria is phosphorylated, but recombinant versions lack these modifications unless engineered .

Future Directions

Current gaps include:

Structural Studies: Cryo-EM or NMR analyses of Cyanothece PsbH in complex with PSII subunits.
Functional Mutagenesis: Assessing PsbH’s role in Cyanothece’s unique diurnal nitrogen fixation cycle .

Product Specs

Form

Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes, and we will prepare accordingly.

Lead Time

Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance for arrangement and additional fees.

Notes

Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.

Reconstitution

We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.

Shelf Life

The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid form maintains its stability for 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.

Storage Condition

Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to minimize freeze-thaw cycles.

Tag Info

Tag type is determined during the manufacturing process.

The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize the development of that tag.

Synonyms

psbH; PCC8801_1645; Photosystem II reaction center protein H; PSII-H

Buffer Before Lyophilization

Tris/PBS-based buffer, 6% Trehalose.

Datasheet

Please contact us to get it.

Expression Region

1-64

Protein Length

full length protein

Species

Cyanothece sp. (strain PCC 8801) (Synechococcus sp. (strain PCC 8801 / RF-1))

Target Names

psbH

Target Protein Sequence

MAQRTGLGDLLRPLNSEYGKVVPGWGTTPLMGVFMGLFLVFLLIILQIYNSSLILEGFTV TWGG

Uniprot No.

B7JW07

Target Background

Function

Photosystem II reaction center protein H (psbH) is a crucial component of the photosystem II (PSII) core complex, essential for its stability and assembly. PSII, a light-driven water:plastoquinone oxidoreductase, harnesses light energy to extract electrons from H2O, producing O2 and a proton gradient that drives ATP formation. It comprises a core antenna complex responsible for photon capture and an electron transfer chain that transforms photonic excitation into charge separation.

Database Links

KEGG: cyp:PCC8801_1645

STRING: 41431.PCC8801_1645

Protein Families

PsbH family

Subcellular Location

Cellular thylakoid membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected

Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Name*

Email*

Phone

Country

Source

Quantity&Size*

Product Name

Message

Recombinant Cyanothece sp. Photosystem II reaction center protein H (psbH)

Description

Table 1: Comparative Properties of Recombinant PsbH Proteins

Functional Role in Photosystem II

Biotechnological Relevance

Technical Considerations

Future Directions

Product Specs

Target Background

Quick Inquiry

Category

Service