Recombinant Cyanothece sp. Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Description

Definition and Basic Properties

The Recombinant Cyanothece sp. Photosystem Q(B) protein (UniProt ID: P51759) is a full-length, His-tagged variant of the D1 protein expressed in Escherichia coli . Key characteristics include:

PropertyDetails
Source OrganismCyanothece sp. ATCC 51142
Expression HostE. coli
TagN-terminal His tag
Protein Length344 amino acids (1–344 aa)
Purity>90% (SDS-PAGE verified)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0) at -20°C

This protein is annotated as Photosystem II protein D1 (PsbA1/PsbA2) and is associated with the oxygen-evolving complex (OEC) of PSII .

Amino Acid Sequence

The protein sequence (MTTTLQQRESVSLWEQFCQWVTSTNNRIYVGWFGTLMIPTLLTATTCFIIAFIAAPPVDI...) includes conserved residues critical for binding the Mn<sub>4</sub>CaO<sub>5</sub> cluster and plastoquinone (Q<sub>B</sub>) . Key structural domains:

  • Plastoquinone Binding Site: Facilitates electron transfer between Q<sub>A</sub> and Q<sub>B</sub> .

  • Mn<sub>4</sub>CaO<sub>5</sub> Ligands: Coordinates the metal cluster essential for water oxidation .

Post-Translational Modifications

  • Processed from precursor pD1 by CtpA protease to mature D1 .

  • Requires reconstitution in deionized water (0.1–1.0 mg/mL) with glycerol for stability .

Functional Role in Photosynthesis

The D1 protein is indispensable for PSII-mediated water oxidation. In Cyanothece sp., its expression is circadian-regulated to balance photosynthesis and nitrogen fixation :

  • Daytime Activity: PSII with standard D1 isoforms mediates water oxidation.

  • Nighttime Activity: A sentinel D1 isoform (encoded by psbA4) lacks Mn<sub>4</sub>CaO<sub>5</sub> ligands, halting water oxidation to protect nitrogenase from oxygen damage .

Redox Regulation

  • The plastoquinone (PQ) pool’s redox state modulates PSII activity and circadian rhythms in Cyanothece .

  • Recombinant D1 enables studies on PQ pool dynamics and PSII repair mechanisms under oxidative stress .

PSII Assembly and Stability

  • Used to investigate lumenal protein interactions (e.g., PsbO, PsbU) that stabilize the OEC .

  • His-tagged variants facilitate affinity purification of intact PSII dimers .

Comparative Studies

D1 IsoformGeneFunctionExpression Condition
Standard D1psbA1/A2Water oxidationDaytime (photosynthesis phase)
Sentinel D1psbA4Blocks water oxidationNighttime (nitrogen fixation)
Low-Oxygen D1psbA1Functional under suboxic conditionsHypoxic environments

Data from .

Industrial and Biotechnological Relevance

  • Protein Engineering: Modifications to the Q<sub>B</sub> site could optimize electron transport for bioenergy applications .

  • Stress Tolerance Studies: Recombinant D1 aids in probing PSII resilience under high light, UV-B, and oxidative stress .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbA1; cce_0636; psbA2; cce_3501; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Cyanothece sp. (strain ATCC 51142)
Target Names
psbA1
Target Protein Sequence
MTTTLQQRESVSLWEQFCQWVTSTNNRIYVGWFGTLMIPTLLTATTCFIIAFIAAPPVDI DGIREPVAGSLLYGNNIVSGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLVIFHFL IGIFCYMGRQWELSYRLGMRPWICVAYSAPVSAATAVFLIYPIGQGSFSDGMPLGISGTF NFMFVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTEIESQNYGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRALHFFLGAWPVIGIWFTAMGVSTMAFNLNGF NFNQSILDSQGRVIGTWADVLNRAGIGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It comprises a core antenna complex responsible for capturing photons and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Database Links
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the Photosystem Q(B) protein and what is its role in cyanobacterial photosynthesis?

The Photosystem Q(B) protein, also known as the D1 protein (PsbA), is a core component of Photosystem II (PSII) in cyanobacteria. It functions as an integral membrane protein that binds the secondary quinone electron acceptor (QB) and facilitates electron transfer during the light-dependent reactions of photosynthesis. In Cyanothece sp., as in other cyanobacteria, the D1 protein contains the binding site for plastoquinone at the QB site, which accepts electrons from the primary quinone acceptor (QA) and is essential for the water-splitting process that generates molecular oxygen . The protein plays a crucial role in maintaining the structural integrity and functional efficiency of PSII, which uses light energy to oxidize water to dioxygen .

How does the structure of Cyanothece sp. Photosystem Q(B) protein differ from that in other cyanobacteria?

While the core structure of the D1 protein (PsbA) is highly conserved across cyanobacteria, Cyanothece sp. PsbA exhibits specific amino acid sequence variations that may confer specialized adaptations. The recombinant protein has a full length of 344 amino acids with a specific sequence that includes domains for quinone binding, chlorophyll coordination, and interaction with other PSII components . Unlike thermophilic cyanobacteria like Thermosynechococcus elongatus and Thermosynechococcus vulcanus where PsbQ is absent in crystal structures, Cyanothece sp. may have different structural arrangements of extrinsic proteins that influence PSII assembly and stability . This structural variation may reflect adaptations to specific environmental conditions, particularly in terms of optimization for diurnal nitrogen fixation cycles characteristic of Cyanothece species.

What expression systems are commonly used for producing recombinant Photosystem Q(B) protein?

For recombinant production of Cyanothece sp. Photosystem Q(B) protein, Escherichia coli is the most commonly utilized expression system. The full-length protein (1-344aa) can be successfully expressed with an N-terminal His-tag for purification purposes . When working with this expression system, researchers should optimize codon usage, induction conditions (temperature, IPTG concentration), and extraction procedures to maximize yield while maintaining proper folding. The recombinant protein is typically purified using affinity chromatography methods that exploit the His-tag, followed by additional purification steps if higher purity is required. It should be noted that membrane proteins like PsbA can be challenging to express in soluble form and may require specialized approaches such as inclusion body solubilization or membrane-mimetic systems for functional studies.

How do mutations in the psbA gene affect electron transfer kinetics in the Photosystem II complex?

Mutations in the psbA gene encoding the Photosystem Q(B) protein can significantly alter the electron transfer kinetics within PSII. Research demonstrates that specific amino acid substitutions in the QB binding pocket can modify the redox potential of the secondary quinone acceptor, thereby affecting the rate of electron transfer from QA to QB . In wildtype systems, the half-time for reoxidation of QA by QB is approximately 220-330 μs in centers with occupied QB sites and 3-6 ms in centers with empty QB sites . When the QB site is modified, either through genetic manipulation or environmental stress (such as UV-B exposure), these kinetics can change dramatically, with potential increases in the half-time for electron transfer and subsequent impacts on water oxidation efficiency.

The impact of mutations can be assessed using chlorophyll fluorescence measurements, particularly through analysis of fluorescence relaxation kinetics after a single turnover flash. Changes in these kinetics can provide quantitative insights into how specific amino acid residues contribute to maintaining optimal electron flow through PSII, with implications for understanding structure-function relationships in photosynthetic complexes from different cyanobacterial species.

What protein-protein interactions are critical for proper assembly and function of the Photosystem Q(B) protein in the PSII complex?

The proper assembly and function of Photosystem Q(B) protein relies on multiple critical protein-protein interactions within the PSII complex. Although specific data for Cyanothece sp. is limited, research on related cyanobacteria provides valuable insights. In Synechocystis sp. PCC 6803, PsbQ (another important PSII protein) closely associates with PsbO and CP47 proteins . Cross-linking studies have revealed specific interaction sites, including cross-links between lysine residues of PsbQ (120K) and PsbO (180K and 59K), as well as between PsbQ (102K) and CP47 (440D) .

The deletion of the psbO gene results in complete absence of PsbQ in PSII complexes and loss of dimeric PSII form, indicating that PsbO is essential for PsbQ incorporation into the complex . These interactions contribute to stabilizing the dimeric form of PSII, which is the most active form of the complex. By extension, the D1 protein (PsbA) in Cyanothece sp. likely engages in similar interactions that collectively maintain PSII structural integrity and optimize electron transfer efficiency between the donor and acceptor sides of the complex.

How does post-translational modification affect the turnover and function of the Photosystem Q(B) protein under various stress conditions?

Post-translational modifications (PTMs) of the Photosystem Q(B) protein play crucial roles in regulating its turnover and function, particularly under stress conditions. The D1 protein undergoes rapid turnover in response to photodamage, and this process is regulated by specific PTMs including phosphorylation, oxidation, and proteolytic cleavage. Under UV-B stress, modifications to the D1 protein affect the binding of plastoquinone and electron transport inhibitors at the QB site . The half-inhibitory concentration for electron transfer from QA to QB increases 4-6 fold following UV-B irradiation, indicating significant structural changes in the QB binding pocket .

Stress ConditionKey PTMFunctional ImpactRecovery Mechanism
High LightPhosphorylationAccelerated D1 degradationEnhanced protein synthesis
UV-B RadiationOxidative modificationImpaired electron transfer to QBWhite light-induced repair
Nutrient LimitationProteolytic processingAltered PSII assemblyStress-specific adaptation

White light exposure during UV-B treatment can mitigate damage, but this protective effect depends on de novo protein synthesis, as it is absent when protein synthesis is blocked by antibiotics like lincomycin . This underscores the importance of the D1 protein repair cycle in maintaining photosynthetic function under stress conditions.

What are the optimal conditions for expressing and purifying recombinant Cyanothece sp. Photosystem Q(B) protein with high yield and functional integrity?

For optimal expression and purification of recombinant Cyanothece sp. Photosystem Q(B) protein, the following protocol is recommended:

  • Expression System: Use E. coli BL21(DE3) with pET-based vectors containing the psbA1 gene fused to an N-terminal His-tag .

  • Culture Conditions:

    • Grow cultures at 37°C until OD600 reaches 0.6-0.8

    • Induce with 0.5-1.0 mM IPTG

    • Shift temperature to 18-20°C after induction

    • Continue expression for 16-18 hours

  • Cell Lysis:

    • Resuspend cell pellet in buffer containing 50 mM Tris-HCl (pH 8.0), 150 mM NaCl, 1 mM PMSF, and 5% glycerol

    • Disrupt cells using sonication or high-pressure homogenization

    • Include 0.5-1% mild detergent (e.g., n-dodecyl-β-D-maltoside) to solubilize membrane-associated protein

  • Purification:

    • Perform immobilized metal affinity chromatography using Ni-NTA resin

    • Apply stepped imidazole gradient (20 mM for washing, 250-300 mM for elution)

    • Further purify using size exclusion chromatography

  • Storage: Aliquot the purified protein and store at -80°C in buffer containing 6% trehalose . Avoid repeated freeze-thaw cycles as they can compromise protein integrity.

To assess functional integrity, measure spectroscopic properties and conduct electron transfer assays. The final product should have greater than 90% purity as determined by SDS-PAGE .

What spectroscopic techniques are most effective for analyzing the functional properties of recombinant Photosystem Q(B) protein?

Several spectroscopic techniques are highly effective for analyzing the functional properties of recombinant Photosystem Q(B) protein:

Each technique offers complementary information, and combining multiple approaches provides the most comprehensive functional characterization.

How can researchers effectively analyze the interaction between recombinant Photosystem Q(B) protein and other PSII components?

To effectively analyze interactions between recombinant Photosystem Q(B) protein and other PSII components, researchers can employ the following methodologies:

  • Chemical Cross-linking coupled with Mass Spectrometry (CL-MS): This approach has been successfully used to identify specific interaction sites between PSII proteins. For example, cross-links between lysine residues of different proteins can be detected and analyzed by liquid chromatography/tandem MS . This technique revealed interactions between PsbQ and both PsbO and CP47 in Synechocystis, providing a template for similar studies with Cyanothece sp. proteins.

  • Co-immunoprecipitation (Co-IP): Using antibodies against the His-tag of recombinant Photosystem Q(B) protein or against native PSII components to pull down protein complexes and identify interacting partners.

  • Surface Plasmon Resonance (SPR): This technique can quantitatively measure binding kinetics and affinities between the recombinant protein and purified PSII components.

  • Isothermal Titration Calorimetry (ITC): Provides thermodynamic parameters of protein-protein interactions, offering insights into the energetics of binding.

  • Fluorescence Resonance Energy Transfer (FRET): By labeling the recombinant protein and potential interacting partners with appropriate fluorophores, researchers can detect proximity-based energy transfer as evidence of interaction.

  • Genetic Approaches: Creating deletion mutants (e.g., ΔpsbO) to assess the impact on Photosystem Q(B) protein incorporation and function within PSII complexes . Such studies have demonstrated that PsbO is essential for PsbQ incorporation in Synechocystis, suggesting potential hierarchical assembly patterns.

These approaches, particularly when used in combination, can provide comprehensive insights into the interaction landscape of Photosystem Q(B) protein within the PSII complex.

What are common issues encountered during recombinant expression of Photosystem Q(B) protein and how can they be resolved?

Common issues during recombinant expression of Photosystem Q(B) protein include:

  • Low Expression Yield:

    • Problem: Membrane proteins like D1/PsbA often express poorly in heterologous systems.

    • Solution: Optimize codon usage for E. coli, lower the induction temperature to 16-18°C, and extend expression time to 18-24 hours. Consider using specialized E. coli strains designed for membrane protein expression, such as C41(DE3) or C43(DE3).

  • Protein Misfolding and Aggregation:

    • Problem: Formation of inclusion bodies containing misfolded protein.

    • Solution: Express at lower temperatures, reduce inducer concentration, or co-express with molecular chaperones. For refolding, use a step-wise dialysis protocol with decreasing concentrations of mild detergents and addition of lipids to mimic the native membrane environment.

  • Proteolytic Degradation:

    • Problem: The expressed protein shows multiple bands on SDS-PAGE indicating degradation.

    • Solution: Include protease inhibitors in all buffers, use protease-deficient E. coli strains, and keep all procedures at 4°C. Consider optimizing the position of the His-tag to minimize proteolytic accessibility.

  • Poor Solubilization:

    • Problem: Difficulty extracting membrane-integrated protein.

    • Solution: Screen different detergents (DDM, OG, LDAO) at various concentrations. Consider extracting with SMA (styrene-maleic acid) copolymers to form native nanodiscs.

  • Low Purity After Affinity Chromatography:

    • Problem: Co-purification of non-specific proteins.

    • Solution: Include imidazole (10-20 mM) in binding and wash buffers, increase salt concentration to reduce ionic interactions, and consider tandem purification strategies using size exclusion chromatography after affinity purification.

How can researchers validate the structural integrity and functional activity of purified recombinant Photosystem Q(B) protein?

To validate the structural integrity and functional activity of purified recombinant Photosystem Q(B) protein, researchers should implement a multi-faceted approach:

  • Structural Integrity Assessment:

    • SDS-PAGE and Western Blot: Confirm the correct molecular weight (expected ~38 kDa plus tag) and immunoreactivity with anti-D1 or anti-His antibodies .

    • Circular Dichroism (CD) Spectroscopy: Evaluate secondary structure composition, particularly the alpha-helical content expected for membrane proteins.

    • Limited Proteolysis: Compare digestion patterns with those of native protein to assess proper folding.

    • Size Exclusion Chromatography: Verify monodispersity and appropriate hydrodynamic radius in detergent micelles.

  • Functional Activity Validation:

    • Quinone Binding Assay: Measure binding affinity for plastoquinone or structural analogs using isothermal titration calorimetry or fluorescence quenching methods.

    • Electron Transfer Measurement: Reconstitute with minimal PSII components and measure electron transfer from artificial donors to quinone acceptors using spectroscopic techniques.

    • Herbicide Binding Assay: Many herbicides (e.g., DCMU) specifically bind to the QB pocket; their binding affinity serves as a proxy for proper folding of this functional domain .

    • Reconstitution into Liposomes: Assess protein orientation and function in a membrane environment using proteoliposomes.

  • Comparative Analysis:

    • Compare spectroscopic properties and activity metrics with those reported for native protein to establish functional equivalence.

    • Perform side-by-side comparison with protein isolated from native sources whenever possible.

A protein that passes these validation tests can be considered structurally intact and functionally competent for further experimental use.

How can recombinant Photosystem Q(B) protein be incorporated into artificial photosynthetic systems for bioenergy applications?

Incorporating recombinant Photosystem Q(B) protein into artificial photosynthetic systems represents an exciting frontier in bioenergy research. The following methodological approach can be employed:

  • Design of Synthetic Membrane Scaffolds:

    • Develop phospholipid or block copolymer membranes optimized for protein incorporation

    • Engineer membrane properties (fluidity, thickness) to match those of native thylakoid membranes

    • Create gradients or compartments that support directional electron transport

  • Reconstitution Strategies:

    • Direct incorporation of purified D1 protein into preformed liposomes using detergent-mediated methods

    • Co-assembly with minimal essential PSII components (D2, cytochrome b559, CP43, CP47)

    • Step-wise addition of extrinsic proteins (PsbO, PsbQ) to stabilize the water oxidation center

  • Coupling to Electron Acceptors:

    • Attach synthetic molecular wires or redox mediators to facilitate electron transfer from QB

    • Incorporate hydrogenase enzymes or catalysts for hydrogen production

    • Create hybrid systems with semiconductor materials for solid-state electron capture

  • Stability Enhancement:

    • Use directed evolution or rational design to improve protein stability

    • Implement protective mechanisms against photodamage, including antioxidant systems

    • Engineer faster D1 turnover cycles to match those observed in natural systems under high light

  • Performance Metrics:

    • Measure quantum efficiency of light energy conversion to chemical energy

    • Determine long-term stability under continuous operation

    • Quantify rates of hydrogen or other biofuel production

These systems must be designed with consideration of the natural repair mechanisms that protect against photodamage in cyanobacteria, as the D1 protein undergoes rapid turnover in vivo, particularly under stress conditions .

What insights can structure-function studies of Photosystem Q(B) protein provide for understanding evolutionary adaptations in cyanobacterial photosynthesis?

Structure-function studies of Photosystem Q(B) protein can provide significant insights into evolutionary adaptations in cyanobacterial photosynthesis:

  • Comparative Sequence Analysis:

    • Analysis of D1 protein sequences across different cyanobacterial species reveals conserved functional domains and species-specific adaptations

    • Multiple psbA genes in many cyanobacteria (including psbA1 and psbA2 in Cyanothece sp.) suggest functional specialization under different environmental conditions

    • Sequence variations in the QB binding pocket correlate with adaptations to different light environments and stress conditions

  • Structural Plasticity and Environmental Adaptation:

    • The absence of certain extrinsic proteins (like PsbQ) in crystal structures from thermophilic cyanobacteria versus their presence in mesophilic species suggests temperature-specific structural adaptations

    • Differences in electron transfer kinetics between species (as seen in comparative studies of C. thermalis and A. marina) reflect adaptations to specific light environments

  • Stress Response Mechanisms:

    • UV-B radiation induces modifications to both donor and acceptor sides of PSII

    • The protective effect of white light against UV-B damage, mediated through protein synthesis-dependent repair , represents an evolved mechanism for maintaining photosynthetic function under fluctuating conditions

    • Variations in D1 turnover rates and repair mechanisms across species correlate with their ecological niches

  • Protein-Protein Interaction Networks:

    • The hierarchy of PSII assembly, where PsbO is required for PsbQ incorporation , reflects evolutionary refinement of the assembly process

    • Cross-species variations in these interaction networks provide insights into the evolutionary trajectory of photosynthetic machinery

These comparative approaches help reconstruct the evolutionary history of photosynthesis and identify adaptations that have allowed cyanobacteria to thrive in diverse ecological niches, from thermophilic hot springs to marine environments.

How do the electron transfer kinetics of Photosystem Q(B) protein differ between Cyanothece sp. and other model cyanobacteria?

Electron transfer kinetics in Photosystem II, particularly those involving the Q(B) site of the D1 protein, display notable variations between cyanobacterial species that reflect evolutionary adaptations to different ecological niches:

  • Comparative Kinetic Analysis:

    • In wild-type Synechocystis sp. PCC 6803, the half-time (t1/2) for reoxidation of QA- by QB is approximately 220 μs in centers with occupied QB sites and 3 ms in centers with empty QB sites

    • After UV-B exposure in Synechocystis, these values increase to 330 μs and 6 ms respectively, indicating stress-induced modification of the QB binding site

    • In C. thermalis grown under far-red light, the slow decay phase attributed to S2QA- recombination has a significantly longer time constant (T3=14.3 ± 4.6 s) compared to white light-grown cells (T3=5.6 ± 2.4 s)

  • Species-Specific Variations in Electron Transfer Components:

SpeciesQA to QB Transfer (t1/2)S2QA- Recombination (t1/2)Notable Adaptations
Synechocystis sp. PCC 6803220 μs13 sMesophilic, freshwater
C. thermalis (white light)Not directly reported5.6 sThermal adaptation
C. thermalis (far-red)Not directly reported14.3 sFar-red adaptation
A. marinaNot directly reported10.8 sChlorophyll d utilization
Cyanothece sp.Not directly reportedNot directly reportedDiurnal nitrogen fixation
  • Functional Implications:

    • The variations in electron transfer kinetics correlate with ecological adaptations, particularly to light quality and quantity

    • Slower recombination rates may represent adaptations to lower light environments or intermittent light availability

    • The presence of multiple psbA genes in Cyanothece sp. (psbA1, psbA2) suggests potential expression of different D1 isoforms with altered kinetic properties under different conditions

  • Methodological Considerations:

    • These kinetic differences are typically measured using chlorophyll fluorescence relaxation after single turnover flashes

    • The presence of electron transfer inhibitors like DCMU can reveal additional details about recombination pathways

    • Temperature dependence of these kinetics provides insights into activation energies of electron transfer reactions, which also vary between species

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.