Recombinant Cyanothece sp. Proton extrusion protein PcxA (pcxA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag.
Synonyms
pcxA; PCC8801_3701; Proton extrusion protein PcxA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-448
Protein Length
full length protein
Species
Cyanothece sp. (strain PCC 8801) (Synechococcus sp. (strain PCC 8801 / RF-1))
Target Names
pcxA
Target Protein Sequence
MKLKSLIKSTSDWFSSTPERALNRAYKSALKIQEIETKHFRGQKVSRENADYGASVITYF ETEVQSYLQKINMELTVFKASRLFLSLSNLQDTENNLGTGKVKSEQETTAIIIFDKLKFI DEVIAKYKSNAIEKNVSNNVAIIAASERNPEVTNSAPSGKKSTKVKDQGVKNKTINFESA SQKTGVLPRSFMNTLNKIKQEIDPKSGESEEQVLTKYRKSRYRTALSIKFILLLIIIPLL IHQLTKTFFLIPVVEQYFSRHEQVIFINRDLEDEALEELQHYEETLHFRGLIGLGPELSP EKIEQEVKQKAGEITEEYRRHGIDSIANIFADLFSFIAFVLVLVNSKKEIEVVKSFLDEI LYGLSDPAKAFLIILFTDMFVGFHSPHGWEVILEGVAHHFGLPENREFNFLFIATFPVIL DTVLKYWIFRYLNRISPSAVATYKNMNE
Uniprot No.

Target Background

Function
This protein is involved in light-induced Na(+)-dependent proton extrusion. It also appears to be involved in CO(2) transport.
Database Links
Protein Families
Cema family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Proton extrusion protein PcxA and what is its role in Cyanothece sp.?

Proton extrusion protein PcxA (pcxA) is a membrane protein found in Cyanothece sp. (strain PCC 8801) that is involved in proton transport across cellular membranes . The protein likely plays a critical role in maintaining cellular pH homeostasis and energy metabolism in this cyanobacterium. Based on its amino acid sequence and predicted structure, PcxA functions by facilitating the movement of protons across membranes, which is essential for various cellular processes including photosynthesis and respiration in cyanobacteria . The protein contains transmembrane domains that anchor it within the cell membrane, allowing it to form channels or pumps for proton translocation.

How is recombinant PcxA protein typically stored and what are the optimal storage conditions?

Recombinant PcxA protein is typically stored in a Tris-based buffer containing 50% glycerol to maintain protein stability . The recommended storage conditions include:

Storage PeriodTemperatureRecommendation
Long-term-20°C or -80°CFor extended storage periods
Medium-term-20°CStandard storage condition
Working aliquots4°CFor up to one week

It is important to note that repeated freezing and thawing cycles should be avoided as this can lead to protein denaturation and loss of activity . Therefore, it is advisable to prepare small working aliquots for routine experiments to minimize freeze-thaw cycles of the main stock.

How does the structure of PcxA relate to other pentapeptide repeat proteins (PRPs) found in cyanobacteria?

While PcxA itself is not explicitly identified as a pentapeptide repeat protein (PRP) in the provided sources, it's valuable to understand the context of PRPs in Cyanothece sp. The genome of Cyanothece sp. PCC 51142 contains 35 pentapeptide repeat proteins, making PRPs particularly abundant in cyanobacteria . These proteins are characterized by tandem pentapeptide repeats that fold into a distinctive right-handed quadrilateral beta-helix structure, referred to as an Rfr-fold .

The structural analysis of the cyanobacterial PRP Rfr32 revealed 21 tandem pentapeptide repeats forming this beta-helix structure, with two short antiparallel alpha-helices at the top connected by a disulfide bond . This structural arrangement appears to prevent edge-to-edge aggregation at the C-terminus. If PcxA contains similar pentapeptide repeat motifs, it might adopt comparable structural features.

The main-chain dihedral orientations in PRPs create two distinct types of four-residue turns (type II and type IV beta-turns) that may represent universal motifs shaping the Rfr-fold in all PRPs . This structural information provides important insights for researchers studying PcxA's tertiary structure and potential functional mechanisms.

What experimental challenges are associated with expressing and purifying recombinant PcxA?

Expressing and purifying membrane proteins like PcxA presents several significant challenges for researchers:

  • Membrane protein solubility: As a membrane protein, PcxA contains hydrophobic domains that make it inherently difficult to solubilize and maintain in solution without appropriate detergents or lipid environments.

  • Expression system selection: Choosing an appropriate heterologous expression system that can properly fold and process membrane proteins is critical. Common systems include E. coli, yeast, insect cells, or mammalian cells, each with distinct advantages and limitations.

  • Protein tagging strategy: The information indicates that "the tag type will be determined during production process" for recombinant PcxA , suggesting that optimization of tagging strategies (His-tag, GST, MBP, etc.) is necessary depending on the specific research requirements.

  • Purification approach: Membrane proteins typically require specialized purification protocols involving initial membrane isolation, followed by solubilization with appropriate detergents, and subsequent chromatographic separation steps.

  • Functional preservation: Maintaining the native structural integrity and functional activity of PcxA throughout the purification process represents a significant challenge requiring careful optimization of buffer conditions, detergent types, and handling procedures.

How can researchers analyze potential structural changes in PcxA under different experimental conditions?

Researchers can employ multiple complementary approaches to analyze structural changes in PcxA under various experimental conditions:

To effectively monitor structural changes, researchers should establish baseline measurements under standard conditions before exposing PcxA to variables such as pH, temperature, salt concentration, or binding partners. Combining multiple techniques provides more comprehensive insights than any single method alone.

What are the most effective protocols for assessing PcxA protein function in vitro?

When assessing PcxA function in vitro, researchers should focus on protocols that evaluate its proton extrusion capabilities:

  • Reconstitution into proteoliposomes: Purified PcxA can be incorporated into artificial lipid vesicles (proteoliposomes) containing pH-sensitive fluorescent dyes such as BCECF or pyranine. Changes in internal pH upon activation can be monitored in real-time using fluorescence spectroscopy.

  • Patch-clamp electrophysiology: For direct measurement of proton currents, PcxA can be studied in planar lipid bilayers or after expression in suitable cell systems amenable to patch-clamp recording.

  • Proton gradient dissipation assays: Measuring the rate at which PcxA dissipates artificially imposed proton gradients across membranes can provide insights into its transport kinetics.

  • ATP synthesis coupling: If PcxA function is linked to bioenergetic processes, coupling assays that measure ATP synthesis in response to proton gradients established by PcxA can be informative.

  • Isotope exchange experiments: Deuterium (²H) or tritium (³H) labeled water can be used to track proton/deuteron movement facilitated by PcxA across membrane barriers.

Each of these methods requires careful optimization of buffer composition, pH, temperature, and membrane/lipid environment to accurately reflect physiological conditions and obtain meaningful functional data.

How can researchers effectively apply Principal Component Analysis (PCA) to PcxA research data?

Principal Component Analysis (PCA) can be a valuable tool for analyzing complex datasets in PcxA research, though researchers should be aware of its limitations and potential pitfalls:

What are the recommended methods for studying protein-protein interactions involving PcxA?

Understanding PcxA's interactions with other proteins is crucial for elucidating its functional network within cyanobacterial cells. Several complementary methods are recommended:

MethodAdvantagesLimitationsApplication to PcxA
Co-immunoprecipitation (Co-IP)Detects native interactionsRequires specific antibodiesCan identify physiological binding partners in cyanobacterial lysates
Pull-down assaysVersatile, works with tagged proteinsMay detect non-physiological interactionsUseful with recombinant tagged PcxA to capture interaction partners
Crosslinking mass spectrometryIdentifies interaction interfacesComplex data analysisCan map specific contact regions between PcxA and partners
Förster Resonance Energy Transfer (FRET)Detects interactions in live cellsRequires fluorescent protein fusionsCan verify interactions in intact cyanobacterial cells
Bimolecular Fluorescence Complementation (BiFC)Visualizes interactions in cellsIrreversible complex formationAllows subcellular localization of interaction sites
Surface Plasmon Resonance (SPR)Measures binding kineticsRequires purified componentsCan determine affinity constants for PcxA interactions
Isothermal Titration Calorimetry (ITC)Provides thermodynamic parametersRequires significant protein amountsCan characterize energetics of PcxA binding interactions

When applying these methods to PcxA research, consideration should be given to the membrane-bound nature of the protein, which may necessitate specialized approaches for maintaining protein stability and native conformations during extraction and analysis.

How should researchers design experiments to study PcxA function in relation to cellular pH regulation?

When designing experiments to investigate PcxA's role in cellular pH regulation, researchers should consider the following comprehensive approach:

  • Genetic manipulation strategies:

    • Generate PcxA knockout mutants in Cyanothece sp. using CRISPR-Cas9 or traditional homologous recombination approaches

    • Create point mutations in key functional residues identified from sequence analysis

    • Develop inducible expression systems to control PcxA levels temporally

  • pH measurement methodologies:

    • Utilize pH-sensitive fluorescent proteins (like pHluorin) expressed in specific cellular compartments

    • Implement microelectrode techniques for single-cell pH measurements

    • Apply pH-sensitive dyes with appropriate calibration curves for population-level measurements

  • Experimental variables to control:

    • Light conditions (intensity, duration, wavelength) given the photosynthetic nature of cyanobacteria

    • Carbon dioxide and bicarbonate concentrations

    • Growth phase of cultures

    • External pH challenges (rapid shifts vs. gradual changes)

    • Presence of additional stressors (salt, temperature, nutrient limitation)

  • Temporal considerations:

    • Design both short-term acute response experiments (minutes to hours)

    • Implement long-term adaptation studies (days to weeks)

    • Consider diurnal cycle effects given Cyanothece's known circadian rhythms

  • Controls and validation:

    • Include complementation studies where mutants are rescued with wild-type PcxA

    • Compare results with other known proton transport systems

    • Validate in vitro findings with in vivo physiological measurements

What considerations are important when interpreting contradictory data regarding PcxA function?

When researchers encounter contradictory data regarding PcxA function, several analytical frameworks should be applied:

  • Methodological assessment:

    • Evaluate differences in experimental systems (heterologous expression vs. native context)

    • Compare purification methods and their potential impact on protein integrity

    • Assess buffer compositions, especially detergents used for membrane protein solubilization

    • Consider temporal factors and sampling methods

  • Biological context analysis:

    • Different cyanobacterial strains may utilize PcxA differently

    • Growth conditions and physiological states may alter PcxA function

    • Interacting partners may vary across experimental systems

    • Post-translational modifications might differ between studies

  • Statistical robustness evaluation:

    • Critically assess sample sizes and biological replicates

    • Evaluate the appropriateness of statistical methods applied

    • Be cautious about PCA-based interpretations given their potential unreliability

    • Consider effect sizes rather than just statistical significance

  • Structural considerations:

    • Protein conformational states may differ between experiments

    • The pentapeptide repeat structure, if present in PcxA (as found in other cyanobacterial proteins), might adopt different folding states based on conditions

    • Oligomerization state differences could explain functional variations

  • Integration approach:

    • Develop mechanistic models that might accommodate seemingly contradictory results

    • Design critical experiments specifically targeting the contradiction points

    • Consider that apparent contradictions might reflect different aspects of a complex multifunctional protein

What are the most promising future research directions for PcxA protein studies?

The most promising future research directions for PcxA protein studies include several interconnected avenues:

  • Structural biology advancements: Obtaining high-resolution structures of PcxA in different conformational states would significantly advance understanding of its mechanism. If PcxA contains pentapeptide repeats similar to other cyanobacterial proteins, exploring whether it forms the characteristic Rfr-fold would be valuable.

  • Systems biology integration: Positioning PcxA within the broader context of cyanobacterial pH regulation and energy metabolism networks would help clarify its physiological significance. This could involve proteome-wide interaction studies and metabolic flux analyses.

  • Environmental adaptation mechanisms: Investigating how PcxA function responds to environmental changes relevant to cyanobacteria, such as light intensity, carbon availability, and temperature fluctuations, could reveal its role in adaptation strategies.

  • Synthetic biology applications: Engineered PcxA variants with modified properties could potentially serve as tools for pH control in synthetic biological systems or as components in artificial photosynthetic devices.

  • Evolutionary biology perspectives: Comparative analyses of PcxA homologs across diverse cyanobacterial species could illuminate the evolutionary history of proton transport mechanisms and their relationship to the development of photosynthesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.