Recombinant Cyanothece sp. UPF0060 membrane protein PCC8801_1733 (PCC8801_1733)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline for your own reconstitution.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
PCC8801_1733; UPF0060 membrane protein PCC8801_1733
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Cyanothece sp. (strain PCC 8801) (Synechococcus sp. (strain PCC 8801 / RF-1))
Target Names
PCC8801_1733
Target Protein Sequence
MNIFRSLLYFFFTGLCEIGGGYLVWLWLKEGKSIKYALLGWGLLMLYGVLPALQTANFGR VYSAYGGAFVIFSLLWGWKVDRIPPDSYDWLGTLIILIGASVIMYAPRN
Uniprot No.

Target Background

Database Links
Protein Families
UPF0060 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage conditions for recombinant PCC8801_1733?

For successful preservation of protein activity, follow these storage guidelines:

  • Store lyophilized protein at -20°C/-80°C upon receipt

  • After reconstitution, add glycerol to 50% final concentration

  • Aliquot to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

  • Use Tris/PBS-based buffer containing 6% trehalose at pH 8.0

For reconstitution:

  • Briefly centrifuge the vial before opening

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • For functional studies, consider reconstitution into artificial liposomes or nanodiscs

What expression systems are most effective for producing functional PCC8801_1733?

While E. coli has been successfully used to express recombinant PCC8801_1733 with high purity (>90%) , several methodological considerations can optimize expression:

Optimization strategies include:

  • Lower induction temperatures (16-25°C) to reduce inclusion body formation

  • Codon optimization for cyanobacterial genes

  • Using autoinduction media for gentler expression

  • Testing multiple detergents during solubilization

  • Exploring fusion tags like SUMO or MBP to improve solubility

What purification protocol yields highest purity and activity for PCC8801_1733?

A methodological approach for optimal purification would include:

  • Cell lysis in buffer containing protease inhibitors

  • Membrane fraction isolation by ultracentrifugation

  • Detergent screening (DDM, LMNG, C12E8) for solubilization

  • Immobilized metal affinity chromatography using His-tag

  • Size exclusion chromatography for higher purity

  • Verification by SDS-PAGE (>90% purity achievable)

Critical factors affecting purification success:

  • Detergent concentration must be above CMC but not excessively high

  • Addition of lipids during purification may stabilize the protein

  • Maintain appropriate ionic strength throughout purification

  • Consider amphipols or nanodiscs for downstream applications requiring detergent removal

What techniques are most effective for determining PCC8801_1733 membrane topology?

Understanding membrane topology is essential for functional characterization. A multi-method approach is recommended:

MethodPrincipleAdvantagesLimitations
Substituted cysteine accessibility (SCAM)Probing accessibility of engineered cysteinesHigh resolutionLabor intensive
Reporter fusion approachesPhoA/GFP activity based on cellular locationWell-establishedMay affect protein folding
Protease protection assaysIdentifying protected fragmentsDirect approachLimited resolution
Fluorescence spectroscopyEnvironmental sensitivity of probesCan be performed in native-like conditionsRequires protein modification

Computational approaches like TMHMM and HMMTOP can provide initial topology predictions to guide experimental design. For PCC8801_1733, which is relatively small (109 amino acids), combining computational prediction with at least two experimental methods would provide reliable topology information.

How does PCC8801_1733 potentially contribute to Cyanothece's unique diurnal cycling?

Cyanothece species exhibit a remarkable ability to perform both photosynthesis and nitrogen fixation within the same cell by temporal separation . While PCC8801_1733's specific role is not fully characterized, several hypotheses warrant investigation:

  • Membrane remodeling during metabolic transitions

  • Transport of metabolites related to carbon storage or nitrogen fixation

  • Involvement in thylakoid membrane organization

Investigation ApproachMethodologyExpected Outcome
Temporal expression analysisRT-qPCR, proteomic analysis at different timepointsCorrelation with specific metabolic phases
Gene knockout studiesCRISPR-based editing, phenotypic analysisFunctional impact on cycling
Protein-protein interactionsCo-IP, bacterial two-hybrid, proximity labelingIdentification of interaction partners
Localization studiesImmunogold EM, fluorescent protein fusionsSubcellular distribution patterns

The unique fatty acid composition of Cyanothece sp. PCC 8801, particularly its high myristic acid (14:0) content , may also relate to specialized membrane functions that involve proteins like PCC8801_1733.

What structural biology methods can be applied to characterize PCC8801_1733?

PCC8801_1733's relatively small size (109 amino acids) makes it amenable to multiple structural approaches, though its membrane nature presents challenges:

MethodApproach for PCC8801_1733Technical Considerations
X-ray crystallographyLipidic cubic phase (LCP) crystallizationRequires extensive detergent screening
Cryo-electron microscopySingle-particle analysis, potentially in nanodiscsMay be challenging due to small size
NMR spectroscopySolution NMR for soluble domains, solid-state NMR for full proteinRequires isotopic labeling
Computational modelingAlphaFold2 or RoseTTAFold predictionValidation required through experiments

For x-ray crystallography, specific approaches include:

  • Systematic detergent screening for stability and homogeneity

  • LCP crystallization with monoolein-based mesophases

  • Use of antibody fragments or designed binding proteins as crystallization chaperones

For cryo-EM:

  • Incorporation into nanodiscs to increase particle size

  • Use of specialized grids to improve particle distribution

  • High-resolution data collection with motion correction

How can bioinformatic approaches help predict PCC8801_1733 function?

Given the uncharacterized nature of the UPF0060 protein family, computational methods can generate testable functional hypotheses:

  • Homology detection beyond standard BLAST:

    • Position-Specific Iterated BLAST for distant homologs

    • Hidden Markov Model profile searches

    • Protein threading approaches

  • Structural prediction and analysis:

    • Contemporary methods like AlphaFold2

    • Binding site prediction and surface mapping

    • Molecular dynamics simulations in membrane environments

  • Genomic context analysis:

    • Examination of consistently co-localized genes

    • Integration with metabolic pathway information

    • Analysis of transcriptomic data across conditions

Data Integration ApproachTools/MethodsExpected Insights
Sequence-structure-functionHHpred, Phyre2, I-TASSERPotential functional analogs
Co-evolution analysisDirect Coupling Analysis, EVcouplingsResidue interactions and interfaces
Genomic neighborhoodSTRING, GeConT, FgenesBFunctional associations

What methods can identify potential interaction partners of PCC8801_1733 in Cyanothece?

Membrane protein interactions present unique challenges requiring specialized approaches:

MethodPrincipleImplementation for PCC8801_1733
Bacterial two-hybridTranscriptional activation via interactionModified with transmembrane domains (BACTH system)
Proximity labelingBiotinylation of nearby proteinsBioID or TurboID fusion to PCC8801_1733
Co-immunoprecipitationPhysical isolation of complexesOptimize detergent conditions to maintain interactions
Crosslinking-MSCovalent linkage of interacting proteinsMembrane-permeable crosslinkers of varying lengths

For in vivo studies in Cyanothece:

  • Consider the diurnal cycle when designing experiments

  • Implement time-course sampling to capture state-dependent interactions

  • Compare interaction profiles between photosynthetic and nitrogen-fixing states

For in vitro reconstitution:

  • Co-reconstitute purified proteins in liposomes or nanodiscs

  • Assess functional interdependence through activity assays

  • Analyze complex formation by native PAGE or size exclusion chromatography

What mutagenesis approaches can determine critical functional domains of PCC8801_1733?

Systematic mutagenesis can reveal structure-function relationships:

StrategyMethodologyApplication to PCC8801_1733
Alanine scanningReplace native residues with alanineFocus on charged, polar, and conserved residues
Conserved residue targetingModify evolutionarily conserved positionsBased on alignments with other cyanobacterial homologs
Transmembrane domain alterationModify membrane-spanning regionsTest membrane insertion and topology requirements
Domain swappingCreate chimeric proteinsReplace domains with related UPF0060 family proteins

Analysis of mutants should include:

  • Expression and stability assessment by western blotting

  • Membrane integration verification

  • Interaction studies with potential partners

  • Phenotypic characterization in Cyanothece, especially regarding diurnal cycling

How can PCC8801_1733 be studied in the context of Cyanothece's fatty acid metabolism?

Cyanothece sp. PCC 8801 exhibits a unique fatty acid profile with high levels of myristic acid (14:0) reaching nearly 50% of total fatty acids . While PCC8801_1733 is distinct from the fatty acid-related enzyme identified in search result (PCC8801_1274), potential functional relationships may exist:

Investigation ApproachMethodologyResearch Question
Lipidomic analysisLC-MS/MS of membrane lipidsDo PCC8801_1733 mutants show altered fatty acid profiles?
Metabolic labelingIsotope-labeled fatty acid precursorsIs PCC8801_1733 involved in fatty acid trafficking?
Localization studiesCo-localization with lipid biosynthesis enzymesSpatial relationship to fatty acid metabolism

The unique esterification pattern of myristic acid to the sn-2 position of glycerolipids in Cyanothece may relate to specialized membrane properties that could involve UPF0060 family proteins like PCC8801_1733.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.