Recombinant Cyanothece sp. UPF0754 membrane protein Cyan7425_4067 (Cyan7425_4067)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
Cyan7425_4067; UPF0754 membrane protein Cyan7425_4067
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-406
Protein Length
full length protein
Species
Cyanothece sp. (strain PCC 7425 / ATCC 29141)
Target Names
Cyan7425_4067
Target Protein Sequence
MALSVPPIAGAIIGYFTNDLAITMLFRPYKPIKIGQRTLPFTPGLIPANQERLARRISDA IMGSLLTPEELQKLTRRLLQTERVQAAIQWLLKMALDQVQSETEQKSAQVLAHILHDLLG SAIPRLIRVWARREDFLEAQLNQIFDQVLLELKLSEEQAGRIADWLLQVVLPPDRLRQTL IDFLTDRNIQVIDEDLREKTSGTYWVVANLFGVRNTLIRLRDFCIEEREACNVRLAELMD ALGVRQRLIEGLQDLSLQNLPVATVRQLRKVFRQNVRIYIQSQGLELVKGLSDSLNWEHV SLSILNRLRSSTAVTASLEVVSQELALVLERYLERDLEIIVEKAIPILNLDEVIVERVKA TTPQELEAAIQGIVKSELQAIVTLGGVLGLLIGIAQSVLLLVQGGL
Uniprot No.

Target Background

Database Links
Protein Families
UPF0754 family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

Which expression systems are available for producing this protein?

Based on the available information, Recombinant Cyan7425_4067 has been successfully expressed in two different systems:

  • E. coli expression system: The full-length protein (1-406 amino acids) has been expressed with an N-terminal His tag, resulting in a product with greater than 90% purity as determined by SDS-PAGE .

  • Yeast expression system: A partial version of the protein has been expressed in yeast with greater than 85% purity as determined by SDS-PAGE .

The choice between these expression systems depends on research objectives. E. coli offers advantages of rapid growth, simple genetics, and cost-effectiveness, but may have limitations regarding post-translational modifications. Yeast provides eukaryotic processing capabilities that might improve protein folding for some membrane proteins, though with slower growth rates and more complex genetics .

What storage conditions are recommended for this recombinant protein?

For optimal stability and activity of Recombinant Cyan7425_4067, the following storage conditions are recommended:

  • Long-term storage: Store at -20°C/-80°C. The lyophilized form has a shelf life of approximately 12 months, while the liquid form has a shelf life of approximately 6 months at these temperatures .

  • Working aliquots: Store at 4°C for up to one week .

  • Avoid repeated freeze-thaw cycles: This can lead to protein degradation and loss of activity .

For reconstitution of lyophilized protein:

  • Briefly centrifuge the vial before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being the default recommendation)

  • Aliquot to minimize freeze-thaw cycles

  • The protein is typically supplied in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0

How should researchers approach solubilization and purification of Cyan7425_4067?

Membrane proteins like Cyan7425_4067 require specific strategies for solubilization and purification:

  • Initial solubilization: Extraction from membranes requires careful selection of detergents. Consider screening:

    • Mild detergents like n-dodecyl-β-D-maltoside (DDM)

    • CHAPS (3-[(3-cholamidopropyl)dimethylammonio]-1-propanesulfonate)

    • Digitonin

    • Triton X-100 (for initial screening, though not ideal for structural studies)

  • Affinity purification: Utilize the N-terminal His tag for immobilized metal affinity chromatography (IMAC). Optimize imidazole concentrations in wash and elution buffers to balance purity with yield .

  • Secondary purification: Following IMAC, size-exclusion chromatography (SEC) can further enhance purity and assess the homogeneity of the protein-detergent complex.

  • Sample preparation for structural studies:

    • For X-ray crystallography: Screen various detergents and lipids to identify conditions that promote crystal formation

    • For NMR: Consider detergent micelles, bicelles, or nanodiscs, depending on protein size

    • For cryo-EM: Reconstitution in nanodiscs or amphipols may provide a more native-like environment

The purification strategy should be tailored to the downstream application while monitoring protein stability throughout the process.

What methods are appropriate for assessing the quality and integrity of purified Cyan7425_4067?

Multiple complementary techniques should be employed to comprehensively assess the quality of purified Cyan7425_4067:

  • SDS-PAGE: To verify protein purity and apparent molecular weight. The recombinant Cyan7425_4067 has been reported with >90% purity by SDS-PAGE .

  • Western blotting: Using anti-His antibodies to confirm the presence of the His-tagged protein.

  • Size-exclusion chromatography (SEC): To assess homogeneity and detect aggregation or oligomerization states.

  • Circular dichroism (CD) spectroscopy: To evaluate secondary structure content and confirm proper folding.

  • Thermal shift assays: To assess protein stability under various buffer conditions.

For membrane proteins specifically:

  • Detergent screening: Using fluorescence-detection size exclusion chromatography (FSEC) to identify detergents that maintain protein stability and homogeneity.

  • Reconstitution tests: Assessing the protein's ability to incorporate into liposomes or nanodiscs, which can indicate preservation of native structure.

  • Limited proteolysis: Well-folded proteins typically show resistance to proteolysis compared to misfolded variants.

A systematic quality assessment using these techniques provides confidence in the protein sample before proceeding to functional or structural studies .

How can researchers optimize expression conditions for improved yields of Cyan7425_4067?

Optimizing expression of membrane proteins like Cyan7425_4067 requires systematic testing of multiple parameters:

  • Expression Host Selection:

    • E. coli strains specifically designed for membrane protein expression (C41(DE3), C43(DE3))

    • Yeast systems (S. cerevisiae or P. pastoris) for potentially better folding

    • The data indicates successful expression in both E. coli and yeast systems

  • Vector Design and Optimization:

    • Codon optimization for the chosen expression host

    • Testing different promoters (T7, tac, ara) for optimal expression levels

    • Inclusion of fusion partners (MBP, SUMO, GFP) to enhance folding and monitor expression

  • Expression Conditions:

    ParameterRecommendationRationale
    Temperature18-25°CLower temperatures reduce aggregation and stress
    Induction OD0.6-0.8Balance between cell density and metabolic state
    Inducer concentrationReduced levelsLower expression rate may improve folding
    MediaRich or minimal with supplementsDependent on intended applications
    Duration12-24 hoursBalance between yield and toxicity
  • Monitoring Cell Stress Responses:

    • Assess upregulation of stress response genes during expression

    • Implement strategies to mitigate stress (co-expression of chaperones, slower expression rates)

A systematic approach using Design of Experiments (DoE) methodology can efficiently identify optimal conditions while minimizing the number of experiments required .

What structural characterization methods are most suitable for Cyan7425_4067?

The structural characterization of Cyan7425_4067 can be approached using several complementary methods:

  • X-ray Crystallography:

    • Requires well-diffracting crystals, which can be challenging for membrane proteins

    • Recent advances with free-electron lasers allow for micro- or nano-crystallography

    • Would require extensive crystallization screening with various detergents and lipids

  • NMR Spectroscopy:

    • For a 406-amino acid membrane protein, solution-state NMR presents size challenges

    • TROSY (Transverse Relaxation-Optimized Spectroscopy) and specific isotope labeling could extend the size limit

    • Solid-state NMR could be applied to Cyan7425_4067 in a lipid bilayer environment

    • May provide valuable dynamics information not accessible by other methods

  • Cryo-Electron Microscopy (cryo-EM):

    • Increasingly powerful for membrane proteins, especially larger ones

    • Does not require crystallization

    • May be combined with nanodiscs for a more native-like environment

    • Recent advances have dramatically improved resolution for membrane proteins

A strategic approach might involve initial characterization by negative-stain EM to assess sample quality, followed by either cryo-EM or crystallization trials depending on protein stability and homogeneity .

How can researchers design functional assays for an uncharacterized protein like Cyan7425_4067?

Since UPF0754 membrane protein Cyan7425_4067 belongs to an uncharacterized protein family, designing functional assays requires a multi-faceted approach:

  • Binding Assays:

    • Identify potential ligands through computational predictions or screening approaches

    • Surface Plasmon Resonance (SPR) or Microscale Thermophoresis (MST) to detect binding interactions

    • Pull-down assays to identify protein-protein interactions in Cyanothece sp. extracts

  • Reconstitution Experiments:

    • Incorporation into liposomes to assess membrane integration

    • Measure effects on membrane properties (fluidity, permeability)

    • Electrophysiology studies if channel or transporter activity is suspected

  • Comparative Studies:

    • Complementation assays in knockout strains of related cyanobacteria

    • Heterologous expression in model organisms to observe phenotypic effects

  • Structural Dynamics:

    • Hydrogen/deuterium exchange mass spectrometry to identify flexible regions

    • FRET-based assays to detect conformation changes upon exposure to different conditions

  • In silico Approaches:

    • Molecular dynamics simulations to predict conformational dynamics

    • Sequence analysis to identify conserved functional motifs

For an uncharacterized protein, pursuing multiple parallel approaches provides the best chance of identifying functional characteristics.

What strategies can be employed to address membrane protein instability during experiments?

Maintaining stability of membrane proteins like Cyan7425_4067 throughout experiments requires specific strategies:

  • Detergent Optimization:

    • Screen multiple detergents using thermal stability assays

    • Consider detergent mixtures that can better mimic the native membrane environment

    • Maintain detergent concentrations above critical micelle concentration (CMC) throughout all steps

  • Buffer Optimization:

    • Systematic screening of buffer components (pH, salt concentration, additives)

    • Addition of glycerol (5-20%) to improve stability

    • Inclusion of specific lipids that may be required for proper folding and function

  • Stabilizing Additives:

    • Cholesterol hemisuccinate for proteins from cholesterol-containing membranes

    • Specific ligands or substrate analogs that can stabilize particular conformations

    • Lipids from the native organism (Cyanothece sp.) may provide specific stabilization

  • Alternative Membrane Mimetics:

    • Nanodiscs to provide a more native-like bilayer environment

    • Amphipols as alternatives to detergents for improved stability

    • Lipidic cubic phases for crystallization attempts

  • Temperature Control:

    • Maintain samples at 4°C during purification and handling

    • Avoid freeze-thaw cycles by preparing appropriate aliquots

    • Consider stability at room temperature for specific applications

Implementing these strategies systematically can significantly improve protein stability and sample homogeneity for downstream applications .

How can researchers distinguish between properly folded and misfolded Cyan7425_4067?

Distinguishing between properly folded and misfolded membrane proteins is critical for meaningful studies:

  • Biophysical Approaches:

    • Circular Dichroism (CD) Spectroscopy: Provides information about secondary structure content

    • Fluorescence Spectroscopy: Intrinsic tryptophan fluorescence can indicate tertiary structure

    • Thermal Denaturation: Properly folded proteins typically show cooperative unfolding transitions

  • Detergent Resistance:

    • Properly folded membrane proteins typically remain soluble when diluted below the critical micelle concentration (CMC) of mild detergents

    • Resistance to harsh detergents (e.g., SDS at room temperature) can distinguish between folded and unfolded states

  • Limited Proteolysis:

    • Well-folded proteins show characteristic and limited digestion patterns

    • Misfolded proteins typically show rapid and complete degradation

  • Membrane Insertion Tests:

    • Reconstitution into liposomes or nanodiscs

    • Proper insertion can be assessed by protease protection assays

  • Analytical Ultracentrifugation:

    • Can distinguish between properly folded monomers and various oligomeric or aggregated states

For Cyan7425_4067, an integrated approach combining several of these methods would provide the most reliable assessment of folding status .

What are effective approaches to troubleshoot low yields in Cyan7425_4067 purification?

Low yields during membrane protein purification can stem from multiple sources:

  • Expression-Level Issues:

    • Problem: Poor expression in the host system

    • Diagnostic: Western blot of whole cell lysates to confirm expression level

    • Solutions:

      • Test alternative promoters or expression hosts

      • Optimize induction conditions (time, temperature, inducer concentration)

      • Consider codon optimization for the expression host

  • Solubilization Efficiency:

    • Problem: Inefficient extraction from membranes

    • Diagnostic: Compare protein content in membrane fraction before and after solubilization

    • Solutions:

      • Screen different detergents (type, concentration, solubilization time)

      • Optimize buffer conditions (pH, salt concentration, additives)

  • Purification Losses:

    • Problem: Protein loss during purification steps

    • Diagnostic: Track protein at each purification stage

    • Solutions:

      • Optimize binding and elution conditions for affinity chromatography

      • Minimize unnecessary steps and transfers

      • Ensure protein stability in purification buffers

  • Protein Aggregation:

    • Problem: Formation of insoluble aggregates during purification

    • Diagnostic: Analyze pellet after centrifugation steps; monitor SEC profiles

    • Solutions:

      • Maintain constant detergent concentration above CMC

      • Include stabilizing additives (glycerol, specific lipids)

      • Consider milder purification conditions

A systematic approach would involve establishing which of these factors is primarily responsible for low yields, then implementing targeted strategies to address the specific issues identified.

How can researchers address challenges related to structural studies of Cyan7425_4067?

Structural studies of membrane proteins like Cyan7425_4067 face specific challenges that require targeted approaches:

  • Crystallization Difficulties:

    • Challenge: Obtaining well-diffracting crystals

    • Solutions:

      • Extensive screening of detergents, lipids, and crystallization conditions

      • Consider lipidic cubic phase (LCP) crystallization

      • Engineer constructs with improved crystallization properties (remove flexible regions, add stabilizing mutations)

      • Use crystallization chaperones (antibody fragments, nanobodies)

  • NMR Size Limitations:

    • Challenge: Size constraints for solution NMR (406-amino acid protein plus detergent micelle)

    • Solutions:

      • Consider solid-state NMR approaches

      • Use selective isotope labeling strategies

      • Apply TROSY and other advanced techniques to improve spectral quality

      • Focus on specific domains or fragments if whole-protein studies are challenging

  • Sample Heterogeneity for Cryo-EM:

    • Challenge: Conformational heterogeneity limiting resolution

    • Solutions:

      • Stabilize protein with ligands or nanobodies

      • Optimize sample preparation (detergent concentration, grid type)

      • Apply 3D classification algorithms to separate conformational states

      • Consider reconstitution in nanodiscs for improved particle visibility

  • Protein Stability During Data Collection:

    • Challenge: Protein degradation during extended data collection

    • Solutions:

      • Verify sample integrity before and after experiments

      • Optimize buffer conditions for maximum stability

      • Consider crosslinking approaches for particularly unstable proteins

      • Use freshly prepared samples whenever possible

These strategies should be tailored to the specific properties of Cyan7425_4067 and the particular structural technique being employed.

How does Cyan7425_4067 compare to UPF0754 family proteins in other cyanobacteria?

The UPF0754 family of membrane proteins is found across various cyanobacterial species, with Cyan7425_4067 being a specific member from Cyanothece sp. PCC 7425. Comparative analysis reveals:

  • Sequence Conservation:

    • UPF0754 family proteins typically show moderate sequence identity across cyanobacterial species

    • Conservation patterns can highlight functionally important residues

    • A multiple sequence alignment would identify regions under evolutionary constraint

  • Structural Predictions:

    • Despite sequence variations, secondary structure predictions typically show a consistent pattern of transmembrane helices

    • The number and arrangement of transmembrane domains can provide clues about function

  • Genomic Context:

    • Analysis of neighboring genes may provide functional insights

    • Co-occurrence with particular metabolic pathways might suggest biological role

    • Conservation of genomic organization across species can indicate functional relationships

  • Experimental Considerations:

    • Experience with expression and purification of homologs can guide approaches for Cyan7425_4067

    • Successful functional assays for related proteins may be adaptable

A comprehensive phylogenetic analysis combined with available experimental data on UPF0754 family members would provide context for interpreting results obtained with Cyan7425_4067 .

What future research directions might unlock the function of Cyan7425_4067?

Elucidating the function of an uncharacterized membrane protein like Cyan7425_4067 requires an integrated approach:

  • Structural Determination:

    • Obtaining high-resolution structural information would provide significant insights into potential function

    • Even partial structural information could guide functional hypotheses and experimental design

  • Systems Biology Approaches:

    • Transcriptomic analysis to identify conditions where the gene is up- or down-regulated

    • Metabolomic profiling of knockout mutants to identify affected pathways

    • Interaction mapping to identify protein partners and potential functional complexes

  • Evolutionary Analysis:

    • Deep phylogenetic analysis across diverse cyanobacterial species

    • Identification of co-evolved gene clusters suggesting functional relationships

    • Comparison with distantly related proteins that may share structural features

  • Advanced Biophysical Characterization:

    • Single-molecule approaches to study dynamics and conformational changes

    • Native mass spectrometry to identify bound cofactors or small molecules

    • Advanced electron microscopy to visualize the protein in its native membrane context

  • Computational Predictions:

    • Machine learning approaches to predict function from sequence and structure

    • Molecular dynamics simulations to identify potential binding sites or conformational changes

    • Integrative modeling combining low-resolution experimental data with computational predictions

The integration of these approaches offers the best opportunity to uncover the biological function of this uncharacterized membrane protein and potentially reveal new aspects of cyanobacterial physiology and metabolism .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.