Recombinant Cyberlindnera jadinii Squalene synthase (ERG9)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ERG9; Squalene synthase; SQS; SS; FPP:FPP farnesyltransferase; Farnesyl-diphosphate farnesyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-443
Protein Length
full length protein
Species
Cyberlindnera jadinii (Torula yeast) (Pichia jadinii)
Target Names
ERG9
Target Protein Sequence
MGKLLQLALHPDELASIVQFKLFRKNENARNPATESAELIRCYELLNLTSRSFAAVIEEL HPELRNVIMVFYLVLRALDTVEVDMSIENSVKLPVLRQFHEKLDTKDWTFDGNSPNEKDR CVLVEFDRILGQYHELKPQYQKVIKEITEKMGNGMADYIENENFNSNGLLTIEDYDLYCY YVAGLVGDGLTQLIVLAKFGNSELSVNKQLFKSMGLFLQKTNIIRDYEEDQVDGRAFWPK EIWGKYANELSDFMKPENQSQGLWCISELVCNALDHVIDVLQYLALVEEQTSFNFCAIPQ VMAIATLELVFQNPQVLTQHVKIRKGTTVSLILESRTLEGCARIFRRYLRKIHHKSHPSD PNYLRLGITIGKIEQFLDGMYPHYVPKGITPQTTSIRTQVVKRLQLDEPMKRDIDEEILK TRILLLSLGVAVFGVVYGVVRII
Uniprot No.

Target Background

Function
Catalyzes the condensation of two farnesyl pyrophosphate molecules to form squalene. This enzyme is the first committed step in the sterol biosynthesis pathway and is essential for ergosterol biosynthesis.
Protein Families
Phytoene/squalene synthase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Cyberlindnera jadinii and its relationship to Candida utilis?

Cyberlindnera jadinii is an ascomycete budding yeast that has significant biotechnological importance, particularly in the food and feed industries. It is recognized as the teleomorphic (sexual) parental species of Candida utilis, with genomic DNA reassociation studies showing approximately 85% similarity between the two yeast species . This close relationship is further confirmed by high similarities in ribosomal RNA sequences between the organisms. C. jadinii can produce ascospores and has both MATa and MATα genes at allelic locations, confirming its sexual reproductive capability . The yeast possesses remarkable metabolic versatility, being able to utilize a wide range of carbon sources including sugars, organic acids, and alcohols, as well as various nitrogen sources such as ammonium, nitrate, urea, and amino acids . This metabolic flexibility contributes to its value in biotechnological applications and explains why researchers often use it as a model organism for studying yeast metabolism and physiology.

What is the function of Squalene synthase (ERG9) in yeast metabolism?

Squalene synthase, encoded by the ERG9 gene, functions as the first committed enzyme in the sterol biosynthesis pathway in fungi and other eukaryotes . The enzyme catalyzes a critical reaction in which two molecules of farnesyl diphosphate are condensed to form squalene, representing a branch point from the isoprenoid pathway toward specific sterol production . This enzymatic step is particularly significant as it directs carbon flux specifically toward sterol biosynthesis rather than other isoprenoid-derived compounds. In yeasts such as Cyberlindnera jadinii, the primary sterol produced is ergosterol, which serves essential functions in maintaining membrane integrity, fluidity, and permeability—similar to the role of cholesterol in mammalian cells . Ergosterol also participates in adaptation to environmental stresses and is involved in cell signaling processes. The catalytic activity of Squalene synthase requires specific domains for substrate binding and catalysis, with the full-length C. jadinii ERG9 protein consisting of 443 amino acids that form these functional domains .

What approaches have been developed for genetic manipulation of Cyberlindnera jadinii ERG9?

The genetic manipulation of Cyberlindnera jadinii, including its ERG9 gene, has been significantly advanced through the development of CRISPR/Cas9-based genome editing tools that effectively address the challenges presented by the polyploid genome of this industrial yeast . The developed CRISPR/Cas9 system has demonstrated remarkable efficiency, achieving 100% single-gene knockdown efficiency in the C. jadinii NBRC0988 strain . This technology allows for precise genetic modifications, including targeted gene disruption, replacement, or regulation. For integration of exogenous genes into specific loci, the system achieves near-100% efficiency when using a 50 bp homology arm for a single gene insertion . The efficiency of multiple gene integration depends critically on homology arm length, with optimal results (62.5% efficiency) obtained using approximately 500 bp homology arms for simultaneous integration of three genes . This capability enables complex metabolic engineering approaches involving multiple modifications to the sterol biosynthesis pathway. Additionally, regulated expression systems, such as the tetracycline-regulatable promoter system used for ERG9 regulation in studies with Candida glabrata, demonstrate the feasibility of controlled gene expression for studying essential genes like ERG9 .

What methods can be used to heterologously express and purify recombinant C. jadinii ERG9?

The heterologous expression and purification of recombinant Cyberlindnera jadinii Squalene synthase (ERG9) requires a carefully designed methodological approach to obtain functional protein. The most commonly employed expression system utilizes Escherichia coli, where the full-length ERG9 gene (encoding amino acids 1-443) is cloned into an appropriate expression vector containing an N-terminal His-tag sequence for purification purposes . The expression construct should be designed with codon optimization for E. coli to enhance translation efficiency, as yeast and bacterial codon preferences differ significantly. After transformation into a suitable E. coli expression strain (such as BL21(DE3)), protein expression is typically induced using IPTG or auto-induction systems under optimized conditions of temperature, induction time, and media composition. Following expression, cells are harvested by centrifugation and lysed using methods such as sonication or high-pressure homogenization in an appropriate buffer containing protease inhibitors . The His-tagged protein can then be purified using immobilized metal affinity chromatography (IMAC) with Ni-NTA or similar resins, followed by additional purification steps if necessary, such as size exclusion chromatography to obtain highly pure protein . The purified protein is typically stored in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0, and addition of 5-50% glycerol is recommended for long-term storage at -20°C/-80°C to prevent activity loss through repeated freeze-thaw cycles .

What is the potential of engineered C. jadinii for heterologous sterol production?

Engineered Cyberlindnera jadinii strains have demonstrated remarkable potential for heterologous sterol production, particularly when modified using advanced genetic engineering techniques such as CRISPR/Cas9 . By strategically manipulating the sterol biosynthesis pathway, researchers have successfully engineered C. jadinii strains capable of producing valuable sterols that are not naturally synthesized by this yeast. In shake-flask fermentation experiments, engineered strains produced 92.1 mg/L of campesterol and 81.8 mg/L of cholesterol, demonstrating the feasibility of redirecting the native sterol pathway toward heterologous sterol production . The productivity of these engineered strains was significantly enhanced through optimization of fermentation conditions, particularly through high-cell-density fed-batch fermentation in a 5 L bioreactor . Under these optimized conditions, campesterol production reached impressive titers of 807 mg/L with a biomass OD600 of 294 and productivity of 6.73 mg/(L·h) . Even more remarkably, cholesterol production achieved gram-scale titers of 1.52 g/L with a biomass OD600 of 380 and productivity of 9.06 mg/(L·h), representing the first reported gram-scale production of steroidal compounds in C. jadinii . These achievements highlight the significant potential of this yeast as a platform organism for industrial-scale production of valuable sterols and steroid compounds through metabolic engineering approaches.

How does the ploidy of C. jadinii affect genetic manipulation strategies?

The complex ploidy profile of Cyberlindnera jadinii presents distinct challenges for genetic manipulation that require specialized approaches and considerations. While C. jadinii is generally considered diploid, detailed genomic analyses have revealed a more intricate ploidy landscape with regions that appear to be haploid, triploid, or even tetraploid . This mosaic ploidy structure means that multiple alleles of target genes may be present, necessitating strategies that can effectively modify all copies simultaneously. The development of CRISPR/Cas9 systems has been particularly valuable in addressing these challenges, as demonstrated by the achievement of 100% knockdown efficiency for single genes despite the polyploid nature of the genome . When designing gene integration experiments, the variable ploidy across the genome must be considered when selecting target loci, as integration efficiency may vary depending on the ploidy state of the target region. The length of homology arms significantly influences integration efficiency in polyploid contexts, with longer homology arms (approximately 500 bp) yielding considerably higher efficiency for multiple gene integrations compared to shorter sequences . Additionally, the selection of appropriate markers becomes more critical in polyploid organisms, as dominant selection markers are generally more effective than auxotrophic markers, which would require modification of all alleles to produce the desired phenotype.

What assays can be used to measure Squalene synthase activity in vitro and in vivo?

Several complementary methodological approaches can be employed to accurately measure Squalene synthase activity both in vitro with purified enzyme and in vivo within cellular systems. For in vitro enzymatic assays, the most direct approach involves using radiolabeled substrates such as [14C]-farnesyl diphosphate (FPP) and quantifying the conversion to [14C]-squalene through thin-layer chromatography (TLC) or high-performance liquid chromatography (HPLC) with radiometric detection. Alternative non-radioactive methods include spectrophotometric assays that measure the release of pyrophosphate during the reaction using coupled enzyme systems, or fluorescence-based assays utilizing fluorescently labeled substrates or products. For kinetic characterization, varying substrate concentrations allows determination of key parameters such as Km and Vmax, while the effects of potential inhibitors can be assessed through dose-response experiments calculating IC50 values. In vivo assessment of squalene synthase activity often involves measuring the accumulation of squalene or downstream sterol pathway intermediates using gas chromatography-mass spectrometry (GC-MS) or liquid chromatography-mass spectrometry (LC-MS) techniques following genetic or pharmacological manipulation of ERG9. Additionally, reporter gene constructs where the expression of fluorescent or luminescent proteins is controlled by the ERG9 promoter can provide insights into the transcriptional regulation of the gene in response to various conditions or treatments.

How can CRISPR/Cas9 be optimized for targeting C. jadinii ERG9 in metabolic engineering applications?

Optimizing CRISPR/Cas9 for targeting the ERG9 gene in Cyberlindnera jadinii requires a multi-faceted approach addressing several critical parameters to achieve high editing efficiency. The design of guide RNAs (gRNAs) represents a crucial first step, requiring careful selection of target sequences with high on-target efficiency and minimal off-target potential, which can be predicted using specialized algorithms that account for the unique genomic context of C. jadinii . Expression of the Cas9 and gRNA components must be optimized using promoters that function efficiently in C. jadinii, such as RNA polymerase III promoters (e.g., SNR52) for gRNA expression and strong constitutive or inducible promoters for Cas9 . The delivery method significantly impacts editing efficiency, with transformation protocols requiring optimization for C. jadinii, potentially using electroporation or lithium acetate-based methods adjusted for this specific yeast species. For gene replacement or insertion applications, homology-directed repair (HDR) efficiency can be substantially improved by using longer homology arms (approximately 500 bp), which have been shown to increase integration efficiency up to 62.5% for multiple gene integrations in C. jadinii . The polyploid nature of C. jadinii necessitates strategies to ensure complete modification of all gene copies, such as using multiple gRNAs targeting different regions of the same gene or implementing sequential transformation approaches . Additionally, appropriate selection markers must be carefully chosen, with antibiotic resistance markers often being more effective than auxotrophic markers in polyploid contexts.

What fermentation strategies can maximize heterologous sterol production in engineered C. jadinii strains?

Optimizing fermentation strategies for heterologous sterol production in engineered Cyberlindnera jadinii strains requires a comprehensive approach addressing multiple parameters critical for maximizing productivity and titer. High-cell-density fed-batch fermentation in controlled bioreactors has demonstrated superior performance compared to batch or shake-flask cultivation, achieving remarkable improvements in sterol production . This approach allows for precise control of growth rate through regulated substrate feeding, preventing substrate inhibition while maintaining high metabolic activity. Optimization of media composition is essential, requiring balanced carbon and nitrogen sources, appropriate trace elements, vitamins, and potentially sterol precursors to support both growth and product formation. Dissolved oxygen levels must be carefully controlled, as sterol biosynthesis is an oxygen-dependent process, yet excessive aeration can lead to oxidative stress that may negatively impact production. Temperature and pH control are equally critical, with optimal parameters typically ranging between 28-30°C and pH 5.0-6.0 for C. jadinii cultivation, though these may require strain-specific fine-tuning . The feeding strategy represents perhaps the most crucial aspect, with exponential feeding based on the specific growth rate being particularly effective for maintaining consistent production conditions throughout the fermentation process. Using these optimized approaches, researchers have achieved impressive titers of heterologous sterols, including 807 mg/L of campesterol (productivity 6.73 mg/(L·h)) and 1.52 g/L of cholesterol (productivity 9.06 mg/(L·h)) in 5 L bioreactors, representing the first gram-scale production of steroidal compounds in C. jadinii .

How can researchers analyze the sterol composition of engineered C. jadinii strains?

Comprehensive analysis of sterol composition in engineered Cyberlindnera jadinii strains requires a sophisticated analytical workflow combining multiple extraction and detection methodologies. The initial step involves efficient extraction of sterols from yeast cells, typically achieved through saponification with alcoholic potassium hydroxide followed by liquid-liquid extraction using organic solvents such as hexane or petroleum ether. This process hydrolyzes sterol esters while allowing for the extraction of free sterols into the organic phase. Alternative non-saponification methods using chloroform-methanol mixtures (Folch or Bligh-Dyer methods) can be employed when preserving sterol esters is desired. For qualitative and quantitative analysis, gas chromatography coupled with mass spectrometry (GC-MS) represents the gold standard due to its high sensitivity and selectivity, requiring derivatization of sterols (typically trimethylsilyl ethers) to enhance volatility and chromatographic performance. High-performance liquid chromatography (HPLC) with UV detection at 210-220 nm provides an alternative approach without derivatization requirements, while coupling with mass spectrometry (LC-MS or LC-MS/MS) offers enhanced sensitivity and structural characterization capabilities, particularly useful for identifying novel or unexpected sterol intermediates. For comprehensive sterol profiling, ultra-high-performance liquid chromatography with quadrupole time-of-flight mass spectrometry (UHPLC-QTOF-MS) enables the detection of a wide range of sterols with high resolution and mass accuracy, facilitating the elucidation of complex sterol profiles in engineered strains.

What controls should be included when studying ERG9 function in C. jadinii?

When designing experiments to study ERG9 function in Cyberlindnera jadinii, a comprehensive set of controls is essential to ensure reliable and interpretable results. A wild-type strain should always be included as the primary reference point, providing baseline data for growth characteristics, sterol composition, and ERG9 expression levels under the experimental conditions. For genetic manipulation studies, an empty vector control (for overexpression experiments) or a non-targeting CRISPR control (for knockout/knockdown experiments) is crucial to account for any phenotypic effects resulting from the genetic manipulation system itself rather than the specific modification of ERG9 . Complementation controls, where the ERG9 gene is reintroduced into knockout or knockdown strains, help verify that observed phenotypes are specifically due to ERG9 depletion rather than off-target effects or secondary mutations. When using regulatable promoter systems such as tetracycline-responsive elements, additional controls should include cells containing the regulatable construct but without the inducer/repressor (doxycycline), as well as cells exposed to the inducer/repressor but lacking the regulatable construct . For biochemical analysis of sterol pathways, selective inhibitors targeting specific steps in the pathway can serve as valuable chemical controls to validate analytical methods and interpretation of metabolic profiles. Additionally, when performing in vivo experiments such as those in mouse models, appropriate controls might include strains with mutations in other ergosterol pathway genes to compare the specific effects of ERG9 depletion versus disruption of other steps in the pathway .

How should researchers address potential pleiotropic effects of ERG9 manipulation?

Addressing the pleiotropic effects of ERG9 manipulation requires a multi-faceted experimental approach to distinguish direct effects from secondary consequences. Researchers should implement time-course experiments following ERG9 modulation to separate immediate primary effects from delayed secondary responses, as early timepoints are more likely to reveal direct consequences of altered squalene synthase activity. Conditional expression systems, such as tetracycline-regulatable promoters used in Candida glabrata studies, offer precise temporal control over ERG9 expression and enable researchers to titrate enzyme levels, helping to distinguish threshold-dependent phenotypes from complete loss-of-function effects . Comprehensive metabolomic analysis focusing not only on sterols but also on related isoprenoid pathways can identify metabolic rerouting that may occur when the primary sterol synthesis pathway is disrupted. Transcriptomic profiling through RNA-sequencing at various timepoints following ERG9 manipulation can reveal compensatory gene expression changes and activation of stress response pathways, providing insights into cellular adaptation mechanisms. Complementation experiments using either the native ERG9 gene or heterologous squalene synthases from other organisms can confirm which phenotypes are directly related to loss of enzymatic function rather than structural roles of the protein. Additionally, supplementation experiments with ergosterol or other sterols can determine which phenotypes result specifically from sterol deficiency versus other potential functions of the squalene synthase enzyme or its products . These combined approaches enable researchers to construct a more complete understanding of both the primary functions and secondary consequences of ERG9 activity in Cyberlindnera jadinii.

What factors should be considered when developing an ERG9-based biosensor in C. jadinii?

Developing an effective ERG9-based biosensor in Cyberlindnera jadinii requires careful consideration of multiple design elements to ensure sensitivity, specificity, and robust performance. The promoter selection is critically important, with the native ERG9 promoter being an obvious candidate if the biosensor aims to detect conditions that naturally regulate ERG9 expression, though synthetic promoters containing specific regulatory elements may offer enhanced sensitivity to particular signals. The reporter system must be carefully selected based on the intended application, with fluorescent proteins (such as GFP, YFP, or mCherry) offering single-cell resolution and compatibility with flow cytometry, while luminescent reporters (such as luciferase) potentially providing greater sensitivity for population-level measurements. The dynamic range of the biosensor should be characterized and optimized to ensure a detectable signal difference between basal and induced states, potentially requiring modifications such as including multiple promoter copies or using destabilized reporter variants for more transient responses. Specificity testing is essential to validate that the biosensor responds primarily to the intended signal (such as sterol levels or specific inhibitors) rather than general stress responses, requiring thorough controls with related and unrelated stimuli. The genetic context of the biosensor integration is another important consideration, as the chromosomal location and copy number can significantly impact expression levels and consistency, with integration into a neutral genomic locus potentially minimizing position effects. Finally, the ploidy considerations specific to C. jadinii must be addressed, as the variable ploidy across its genome may affect the consistency of biosensor performance, potentially requiring strategies to ensure uniform integration and expression across all relevant chromosomal copies.

How might systems biology approaches enhance our understanding of ERG9 regulation in C. jadinii?

Systems biology approaches offer powerful frameworks for unraveling the complex regulation of ERG9 in Cyberlindnera jadinii, potentially revealing new targets for metabolic engineering. Multi-omics integration combining transcriptomics, proteomics, and metabolomics data can create comprehensive models of ERG9 regulation under various conditions, identifying correlations between gene expression, protein levels, and metabolite concentrations that conventional single-omics approaches might miss. Genome-scale metabolic models (GEMs) of C. jadinii, incorporating detailed information about the sterol biosynthesis pathway, would enable in silico prediction of how genetic modifications might affect flux distribution throughout the network, guiding experimental design for pathway optimization . Regulatory network reconstruction focusing on transcription factors and regulatory elements controlling ERG9 expression could identify master regulators that might serve as targets for engineering enhanced sterol production. Time-resolved studies capturing dynamic responses to perturbations (such as nutrient limitation, oxygen availability, or inhibitor addition) would provide insights into the temporal aspects of ERG9 regulation, revealing feedback mechanisms and adaptation strategies. Comparative genomics approaches examining ERG9 regulation across related yeast species could identify conserved and divergent regulatory features, potentially uncovering novel control mechanisms specific to C. jadinii. Additionally, single-cell analysis techniques such as single-cell RNA-seq or time-lapse microscopy with fluorescent reporters would reveal cell-to-cell heterogeneity in ERG9 expression and activity, which could have significant implications for population-level productivity in industrial fermentations. These systems-level approaches would complement traditional molecular biology methods, providing a more holistic understanding of ERG9 function within the broader cellular context.

What novel applications might emerge from engineered C. jadinii ERG9 variants?

Engineered variants of Cyberlindnera jadinii ERG9 could enable a range of novel applications beyond traditional sterol production, opening new avenues for research and biotechnology. Substrate-specificity engineering through rational design or directed evolution approaches could generate ERG9 variants capable of accepting non-natural substrates or producing novel squalene analogs, potentially yielding new bioactive compounds with pharmaceutical applications. Temperature-stable or solvent-tolerant ERG9 variants could enhance the enzyme's utility in industrial biocatalysis applications, enabling operations under conditions that might be favorable for downstream processing or integration with chemical synthesis steps. Biosensor applications could be developed using engineered ERG9 variants with altered regulatory properties, creating systems for detecting specific environmental conditions, chemical compounds, or metabolic states relevant to industrial fermentation monitoring or environmental sensing. Protein fusion approaches combining ERG9 with other enzymes in the sterol biosynthesis pathway could create metabolic channeling effects that enhance pathway efficiency by preventing intermediate diffusion and reducing competing reactions. Additionally, engineered ERG9 variants could serve as valuable research tools for studying fundamental aspects of sterol biosynthesis, membrane biology, and drug development. The gram-scale production of sterols already demonstrated in engineered C. jadinii strains provides a foundation for these advanced applications, suggesting that with further optimization and innovative enzyme engineering approaches, this organism could become a versatile platform for diverse sterol-related applications in pharmaceutical, nutraceutical, and chemical industries.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.