Recombinant Cyberlindnera saturnus Cytochrome c oxidase subunit 2 (COX2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the available format, please specify your requirements during order placement for preferential preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
COX2; OXI1; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
12-247
Protein Length
Full Length of Mature Protein
Species
Cyberlindnera saturnus (Yeast) (Williopsis saturnus)
Target Names
COX2
Target Protein Sequence
DVPTPWGLYFQDSSTPNQEGIIELHDNIMFYLVLILCTVSWLLFSIVKDSSKNPLPHKYL VHGQTIEIIWTILPAVVLLIIAFPSFILLYLCDEVISPAMTIKAIGLQWYWRYEYSDFIN DSGETIEFESYVIPEDLLEDGQLRLLDTDTSVVCPVNTHIRFIVSAADVIHDFAIPSLGI KVVASPGRLNQVSALIQREGVYYGMCSETCGVAHSAMPMKIEVVSTKEFLTWLNEQ
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 2 (COX2) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain. This chain, encompassing succinate dehydrogenase (Complex II), ubiquinol-cytochrome c oxidoreductase (Complex III), and cytochrome c oxidase, facilitates electron transfer from NADH and succinate to molecular oxygen. This process generates an electrochemical gradient across the inner mitochondrial membrane, driving ATP synthesis via ATP synthase. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c (in the intermembrane space) are transferred through the copper A center (CuA) of subunit 2 and heme A of subunit 1 to the binuclear center (BNC) in subunit 1. This BNC, comprising heme a3 and copper B (CuB), reduces molecular oxygen to two water molecules, utilizing four electrons from cytochrome c and four protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Cyberlindnera saturnus and why is its COX2 protein of research interest?

Cyberlindnera saturnus (formerly known as Williopsis saturnus) is a non-conventional yeast strain with unique metabolic properties. This yeast is notable for its maltose-negative characteristics, meaning it can only metabolize glucose, fructose, and sucrose from brewer's wort while exhibiting hop tolerance and producing pleasant fruity flavors . The strain has been isolated from soil underneath ash trees in Bavaria, Germany, and identified through D1/D2 26S rDNA sequencing .

The COX2 protein (Cytochrome c oxidase subunit 2) is of particular interest because it plays a critical role in the mitochondrial respiratory chain. As a component of Complex IV, COX2 is essential for cellular respiration and energy production. Research interest in this protein extends to its role in mitochondrial genome diversity across yeasts and its evolutionary relationships within the Saccharomycotina subphylum .

How can researchers effectively use recombinant COX2 in mitochondrial function studies?

To effectively use recombinant COX2 in mitochondrial function studies, researchers should consider the following methodological approach:

  • Protein reconstitution: Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL before use .

  • Experimental design for respiratory chain analysis: The recombinant protein can be used in in vitro assays to study electron transport chain dynamics, particularly focusing on Complex IV activity.

  • Comparative functional studies: Design experiments comparing native and recombinant COX2 to evaluate structural and functional conservation. This is particularly useful when studying the effects of specific mutations on protein function.

  • Interaction studies: Use the His-tagged protein for pull-down assays to identify interaction partners within the respiratory complex.

  • Activity assays: Measure cytochrome c oxidase activity using spectrophotometric methods to assess functional integrity of the recombinant protein.

When designing these experiments, researchers should account for potential differences between the recombinant protein produced in E. coli and the native form found in yeast mitochondria, particularly regarding post-translational modifications.

What analytical techniques are most effective for studying COX2 structure-function relationships?

For investigating structure-function relationships of Cyberlindnera saturnus COX2, several complementary techniques have proven effective:

  • SDS-PAGE analysis: Provides information on protein purity, integrity, and molecular weight .

  • Spectroscopic methods: Circular dichroism (CD) spectroscopy can assess secondary structure, while fluorescence spectroscopy can probe tertiary structure changes in response to experimental conditions.

  • Activity assays: Enzyme kinetic measurements can be correlated with structural features to establish structure-function relationships.

  • Mass spectrometry: For detailed analysis of post-translational modifications and protein-protein interactions.

  • Cryo-electron microscopy: To elucidate the three-dimensional structure of COX2 within the cytochrome c oxidase complex.

  • Comparative genomic analysis: Particularly useful when examining COX2 evolution across different yeast species. Research has shown that COX2 is part of a broader pattern of mitochondrial genome diversity across the Saccharomycotina subphylum .

What are the optimal storage conditions for maintaining recombinant COX2 activity?

For optimal maintenance of recombinant Cyberlindnera saturnus COX2 activity, researchers should follow these evidence-based guidelines:

  • Long-term storage: Store the lyophilized protein at -20°C or -80°C upon receipt .

  • Working solution preparation: For reconstituted protein, add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The recommended default final concentration of glycerol is 50% .

  • Short-term storage: Working aliquots can be stored at 4°C for up to one week .

  • Buffer conditions: The protein is typically stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0 or in Tris-based buffer with 50% glycerol .

  • Freeze-thaw cycles: Repeated freezing and thawing is not recommended as it can lead to protein denaturation and loss of activity .

These storage recommendations are based on experimental evidence showing optimal stability under these conditions, though researchers may need to adapt protocols for specific experimental requirements.

How does COX2 from Cyberlindnera saturnus compare evolutionarily with COX2 from other yeast species?

Evolutionary analysis of COX2 from Cyberlindnera saturnus reveals important insights into yeast mitochondrial genome diversity:

  • Phylogenetic positioning: Cyberlindnera saturnus belongs to the Saccharomycetales order, where intron sharing between species is particularly common. Studies have shown that a small number of introns are shared across yeast groups, particularly within this order .

  • Intron diversity: Research has identified 271 clusters of related introns across yeast species. The COX2 gene in some yeasts has been found to contain introns, though specific information about C. saturnus COX2 introns is limited in the provided sources .

  • Comparative genomics: Within the Saccharomycotina subphylum, COX2 exists alongside other mitochondrially-encoded respiratory chain components like COX1, COX3, and COB (a complex III component) .

  • Evolutionary relationships: C. saturnus is related to other Cyberlindnera species like C. mrakii and C. suaveolens, forming a distinct clade within the Saccharomycetales .

  • Gene transfer phenomena: In some yeasts like Saccharomyces, COX2 has been observed to have 3' terminal elements that could be translated as extensions of upstream genes . This phenomenon might provide insights into the evolution of mitochondrial genome organization.

This evolutionary context is crucial for researchers studying mitochondrial genome evolution and the diversification of respiratory chain components across yeast species.

What is known about potential horizontal gene transfer (HGT) involving COX2 in yeasts?

Research on mitochondrial genome diversity has revealed intriguing patterns of potential horizontal gene transfer (HGT) involving respiratory chain genes in yeasts:

  • Intron mobility: Studies have identified potential intron HGTs based on BLAST comparisons of mitochondrial introns. While most introns observed did not share high sequence similarity with introns from other species (65.6%), about 30% were shared within taxonomic groups .

  • Cross-group intron sharing: A small number of introns were shared across taxonomic groups, particularly within the Saccharomycetales order. This suggests potential HGT events involving these genetic elements .

  • COX2-specific findings: While the provided sources don't detail specific HGT events involving Cyberlindnera saturnus COX2, research has noted that the COX2 gene in some Saccharomyces species has been observed to have 3' terminal elements that may have originated from mobile genetic elements .

  • Research methodology: Clusters containing introns spanning multiple taxonomic groups, particularly those spanning multiple orders, represent the top candidates for HGT events. For example, introns in COX1 genes (which function alongside COX2 in the respiratory chain) from species like Saccharomyces cerevisiae, Hanseniaspora vineae, and potentially Lachancea kluyveri show evidence of possible horizontal transfer .

This area remains an active field of research, with analysis of mitochondrial genomes continuing to reveal complex evolutionary relationships among respiratory chain components.

How can recombinant COX2 be utilized in non-alcoholic beer production research?

While COX2 itself is not directly used in non-alcoholic beer production, understanding the broader context of Cyberlindnera saturnus is relevant for researchers in this field:

  • Yeast strain applicability: Cyberlindnera saturnus TUM 247 has proven suitable for producing non-alcoholic beers due to its inability to metabolize maltose from brewer's wort while still metabolizing glucose, fructose, and sucrose. This metabolic profile limits ethanol production while providing desirable flavor characteristics .

  • Fermentation optimization: Research using response surface methodology (RSM) has helped optimize fermentation parameters for this yeast strain. A face-centered central composite design with three independent factors (original gravity, fermentation temperature, and pitching rate) has been used to determine optimal conditions .

  • Optimal parameters table:

ParameterOptimal Range
Original gravity10.5 °P
Fermentation temperatureModerate (specific to application)
Pitching rateLow
  • Flavor profile analysis: The yeast produces an exceptionally pleasant fruity flavor while maintaining hop tolerance. Studies have used headspace-gas chromatography with olfactometry to analyze secondary metabolites, identifying (E)-β-damascenone as a decisive substance contributing red berry and apple flavor notes .

  • Research applications: Scientists studying functional genomics could explore the relationship between respiratory chain proteins like COX2 and the yeast's unique metabolic capabilities, potentially identifying genetic markers for improved strain selection.

Researchers interested in both fundamental mitochondrial biology and applied fermentation technology can bridge these fields by understanding the connection between respiratory functions and fermentation capabilities.

What methodological approaches should be considered when using recombinant COX2 in protein-protein interaction studies?

When designing protein-protein interaction studies with recombinant Cyberlindnera saturnus COX2, researchers should consider these methodological approaches:

  • Sample preparation:

    • Reconstitute the lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol to 5-50% final concentration for stability

    • Aliquot to avoid repeated freeze-thaw cycles

  • Pull-down assays:

    • Utilize the His-tag for immobilization on Ni-NTA or similar matrices

    • Optimize binding and washing buffers to reduce non-specific interactions

    • Consider mild elution conditions to preserve protein-protein complexes

  • Cross-linking methods:

    • Chemical cross-linkers can stabilize transient interactions

    • MS-compatible cross-linkers enable subsequent identification of interaction sites

    • Optimize cross-linker concentration and reaction time for COX2 specifically

  • Advanced detection techniques:

    • Surface plasmon resonance (SPR) for real-time interaction kinetics

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

    • Microscale thermophoresis (MST) for interactions in solution

  • Controls and validation:

    • Include negative controls (unrelated proteins with similar tags)

    • Validate interactions using multiple orthogonal techniques

    • Confirm biological relevance through functional assays

  • Mitochondrial context considerations:

    • Account for the membrane environment of native COX2

    • Consider reconstitution in artificial membrane systems for more physiologically relevant conditions

    • Evaluate interactions within the context of the complete cytochrome c oxidase complex

These methodological considerations help ensure robust and reproducible results when studying the interaction network of this important respiratory chain component.

What are common issues encountered when working with recombinant COX2 and how can they be addressed?

Researchers working with recombinant Cyberlindnera saturnus COX2 may encounter several challenges. Here are evidence-based solutions to common issues:

  • Protein aggregation:

    • Cause: Improper reconstitution or storage conditions

    • Solution: Reconstitute in recommended buffer systems (Tris/PBS-based, pH 8.0) , avoid repeated freeze-thaw cycles, and maintain glycerol concentrations between 5-50%

    • Validation: Check protein solubility by centrifugation and analyze supernatant by SDS-PAGE

  • Loss of activity during storage:

    • Cause: Protein denaturation or degradation

    • Solution: Store lyophilized protein at -20°C/-80°C and working aliquots at 4°C for no more than one week

    • Validation: Include internal controls in activity assays to monitor performance over time

  • Non-specific binding in interaction studies:

    • Cause: Hydrophobic patches or improperly folded regions

    • Solution: Optimize buffer conditions (salt concentration, detergents) and include appropriate blocking agents

    • Validation: Include negative controls in binding assays

  • Inconsistent experimental results:

    • Cause: Batch-to-batch variability or inconsistent handling

    • Solution: Verify protein quality by SDS-PAGE (>90% purity) before experiments and standardize protocols

    • Validation: Include internal standards and positive controls in each experiment

  • Difficulties in functional assessment:

    • Cause: Recombinant protein may lack post-translational modifications present in native form

    • Solution: Compare results with native protein where possible and consider complementary in vivo approaches

    • Validation: Use multiple activity assays to comprehensively assess function

Maintaining detailed records of protein batches, storage conditions, and experimental parameters will help researchers identify and address these issues systematically.

How can researchers validate the structural integrity and functionality of recombinant COX2?

To ensure recombinant COX2 from Cyberlindnera saturnus maintains its structural integrity and functionality, researchers should implement a multi-faceted validation approach:

  • Purity assessment:

    • SDS-PAGE analysis (target: >90% purity)

    • Mass spectrometry to confirm molecular weight and sequence integrity

    • Western blot with anti-His antibodies to confirm tag presence and integrity

  • Structural validation:

    • Circular dichroism (CD) spectroscopy to assess secondary structure elements

    • Fluorescence spectroscopy to evaluate tertiary structure

    • Limited proteolysis to probe for correctly folded domains resistant to digestion

  • Functional assays:

    • Cytochrome c oxidase activity measurement using spectrophotometric assays

    • Oxygen consumption rate determination

    • Electron transfer capability assessment

  • Interaction validation:

    • Binding assays with known interaction partners from the cytochrome c oxidase complex

    • Co-immunoprecipitation experiments to verify complex formation

    • Thermal shift assays to assess protein stability in different conditions

  • Quality control benchmarks:

ParameterAcceptable RangeValidation Method
Purity>90%SDS-PAGE, densitometry
Molecular weightConsistent with theoretical (plus tag)Mass spectrometry
Secondary structureConsistent with reference proteinCD spectroscopy
Activity>80% of reference standardEnzyme activity assay
StabilityConsistent Tm valueThermal shift assay

By systematically applying these validation approaches, researchers can ensure their experimental results with recombinant COX2 are reliable and physiologically relevant.

What emerging research questions remain to be addressed regarding Cyberlindnera saturnus COX2?

Several important research questions regarding Cyberlindnera saturnus COX2 remain unexplored, representing promising directions for future investigation:

  • Structural uniqueness: How does the three-dimensional structure of C. saturnus COX2 differ from other yeast species, and what functional implications do these differences have? Advanced structural biology techniques like cryo-EM could help resolve this question.

  • Evolutionary adaptations: What selective pressures have shaped COX2 evolution in Cyberlindnera compared to other yeasts? Comparative genomics and positive selection analyses across diverse yeast species could provide insights.

  • Mitochondrial intron dynamics: Do C. saturnus COX2 genes contain introns, and if so, what is their evolutionary history? The evidence of intron sharing and potential horizontal gene transfer in yeast mitochondrial genes makes this a compelling area for investigation .

  • Respiratory efficiency: How does the specific sequence and structure of C. saturnus COX2 influence respiratory efficiency and energy production in this yeast? This question has implications for both fundamental biology and biotechnological applications.

  • Interactome mapping: What is the complete set of protein-protein interactions involving COX2 in C. saturnus, and how does this network differ from other yeasts? Proteomics approaches could help elucidate this interaction landscape.

  • Connection to fermentation capabilities: What is the relationship between respiratory chain function and the unique fermentation properties that make C. saturnus valuable for non-alcoholic beer production ? Exploring this connection could bridge fundamental and applied research.

These questions highlight the rich potential for continued research on this protein, spanning fields from structural biology to evolutionary genomics and biotechnology.

How might comparative studies of COX2 across yeast species inform our understanding of mitochondrial evolution?

Comparative studies of COX2 across yeast species offer valuable insights into mitochondrial evolution:

  • Mitochondrial genome architecture: Analysis of COX2 and other respiratory genes has revealed significant diversity in mitochondrial genome organization across yeasts. Studies show that intron content varies considerably, with evidence of both vertical inheritance and horizontal gene transfer .

  • Evolutionary rate heterogeneity: Comparative studies could determine if COX2 evolves at different rates across yeast lineages, potentially revealing lineage-specific selective pressures.

  • Intron mobility and HGT patterns: Research has identified clusters of related introns across species, with some spanning multiple taxonomic groups. This suggests complex patterns of mobile genetic element transfer throughout yeast evolution .

  • Functional constraints: By comparing COX2 sequence conservation across diverse yeasts with varying ecological niches, researchers can identify functionally critical regions versus more variable domains.

  • Co-evolution with nuclear genes: Mitochondrial genes like COX2 must maintain functional interactions with nuclear-encoded proteins. Comparative studies could reveal co-evolutionary patterns between mitochondrial and nuclear genomes.

  • Adaptive evolution markers: Statistical approaches comparing nonsynonymous to synonymous substitution rates (dN/dS) across COX2 sequences could identify regions under positive selection, potentially linking to adaptive traits.

  • 3' terminal elements: Studies show that in some yeasts, genes like COX2 may have 3' terminal elements that could be translated as extensions of upstream genes . Investigating these features across species could reveal evolutionary mechanisms for gene structure change.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.