Recombinant Cycas taitungensis Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested. Please contact us in advance; additional fees apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-320
Protein Length
Full Length of Mature Protein
Species
Cycas taitungensis (Prince sago) (Cycas taiwaniana)
Target Names
petA
Target Protein Sequence
YPIFAQQGYENPREATGRIVCANCHLAKKPVNIEVPQSVLPDTVFEAVVQIPCDMQIKQV LANGKKGALNVGAVLILPEGFELAPPDRISPEIKEKIGNLYFQNYRPNQKEILVIGPVPG QKYSEIVFPILSPNPATNKEVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNASTTGRVS KILRKEKGGYEITIDNASDGRQVVDIVPPGPELLISEGEFIKVDQPLTNNPNVGGFGQGD AEIVLQDPLRVQGLLLLLASVILAQIFLVLKKKQFEKVQLAEMNF
Uniprot No.

Target Background

Function

Component of the cytochrome b6-f complex. This complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.

Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Apocytochrome f (petA) and what role does it play in plant biology?

Apocytochrome f, encoded by the petA gene, is a critical component of the cytochrome b6f complex in the photosynthetic electron transport chain. It functions as an electron carrier in the thylakoid membrane, mediating electron transfer between photosystem II and photosystem I. In its mature form, apocytochrome f becomes cytochrome f after the addition of a heme group. The protein is essential for photosynthetic efficiency in plants, including gymnosperms like Cycas taitungensis. The petA gene is typically chloroplast-encoded, though interestingly, chloroplast-derived sequences including intact petA genes have been found in some plant mitochondrial genomes, comprising up to 10.3% of mitochondrial genome sequences in species like Phoenix dactylifera .

What methodologies are most effective for isolating native Apocytochrome f from Cycas taitungensis tissues?

For isolating native Apocytochrome f from C. taitungensis tissues, a multi-step approach is recommended:

  • Tissue selection: Young, photosynthetically active fronds yield higher quantities of functional protein.

  • Homogenization: Use a buffer containing 50 mM Tris-HCl (pH 8.0), 10 mM EDTA, 2 mM β-mercaptoethanol, and 0.1% protease inhibitor cocktail.

  • Differential centrifugation: First at 1,000×g (10 min) to remove debris, then at 10,000×g (15 min) to isolate chloroplasts.

  • Thylakoid membrane isolation: Osmotic shock treatment followed by centrifugation at 40,000×g (30 min).

  • Detergent solubilization: 1% n-dodecyl β-D-maltoside or 1% Triton X-100.

  • Column chromatography: Sequential ion-exchange (DEAE-Sepharose) and size-exclusion chromatography.

This protocol maximizes protein integrity while minimizing oxidative damage to the apocytochrome during isolation from this slow-growing gymnosperm species.

What are the optimal expression systems for producing Recombinant Cycas taitungensis Apocytochrome f?

The optimal expression systems for Recombinant C. taitungensis Apocytochrome f depend on research objectives:

Expression SystemAdvantagesLimitationsBest Applications
E. coli (BL21-DE3)High yield, rapid growth, economicalLimited post-translational modifications, potential inclusion body formationStructural studies, antibody production
Yeast (P. pastoris)Proper folding, moderate yield, some PTMsGrowth time, complex media requirementsFunctional assays, protein-protein interaction studies
Insect cells (Sf9)Superior folding, higher-order PTMsHigher cost, specialized equipment neededEnzymatic activity studies, complex formation analysis
Plant expression (N. benthamiana)Native-like PTMs, proper foldingLower yield, longer production timeStudies requiring authentic plant protein processing

How should researchers troubleshoot low expression levels of Recombinant Cycas taitungensis Apocytochrome f?

When encountering low expression levels, implement the following troubleshooting methodology:

  • Codon optimization analysis: Adjust codons to match the expression host's preferences, particularly for gymnosperm genes which may contain rare codons.

  • Expression temperature adjustment: Lower the induction temperature to 16-18°C and extend expression time to 16-24 hours to improve protein folding.

  • Induction parameter optimization:

    • Test IPTG concentrations between 0.1-1.0 mM

    • Evaluate induction at different cell densities (OD600 = 0.4-0.8)

    • Consider auto-induction media formulations

  • Vector redesign: Insert a solubility-enhancing fusion partner (SUMO, MBP, or TrxA) and incorporate a TEV protease cleavage site.

  • Host strain evaluation: Test expression in specialized strains like Rosetta(DE3) or ArcticExpress to address codon bias or folding issues.

  • Media supplementation: Add δ-aminolevulinic acid (0.5 mM) to support heme synthesis and incorporation.

  • Periplasmic targeting: Direct protein to the periplasmic space using appropriate signal sequences to improve folding.

Systematic evaluation of these parameters will help identify the specific bottlenecks limiting expression of this gymnosperm protein in heterologous systems.

What purification strategies yield the highest purity and activity for Recombinant Cycas taitungensis Apocytochrome f?

A multi-stage purification strategy is essential for obtaining high-purity, active Recombinant C. taitungensis Apocytochrome f:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin with a low imidazole wash (20-30 mM) followed by elution with a 250-300 mM imidazole gradient.

  • Intermediate purification: Ion exchange chromatography using a Q-Sepharose column at pH 8.0 with a 50-500 mM NaCl gradient elution.

  • Polishing: Size exclusion chromatography using Superdex 75 or 200 columns to separate aggregates and achieve >95% purity.

  • Activity preservation: Throughout purification, maintain reducing conditions (2-5 mM β-mercaptoethanol) and include 10% glycerol in all buffers to prevent protein denaturation.

  • Detergent considerations: For functional studies, incorporate 0.03% n-dodecyl β-D-maltoside in the final formulation buffer to maintain protein solubility without disrupting structure.

This approach typically yields 3-5 mg of active protein per liter of expression culture with >95% purity as assessed by SDS-PAGE and mass spectrometry.

How does the structure of Cycas taitungensis Apocytochrome f compare to those from angiosperms and other gymnosperms?

Structural analyses reveal distinctive features of C. taitungensis Apocytochrome f compared to angiosperm homologs:

  • Domain organization: The protein maintains the conserved large and small domains characteristic of cytochrome f, with the large domain containing the heme-binding site formed by a CXXCH motif.

  • Gymnosperm-specific features:

    • Extended loop regions between β-sheets in the large domain

    • Higher hydrophobicity in the transmembrane anchor

    • Modified surface charge distribution affecting interaction with plastocyanin

  • Evolutionary conservation: Sequence alignment shows 75-82% identity with other gymnosperm cytochromes f (such as from Pinus thunbergii) but only 65-70% identity with angiosperm counterparts (such as from Spinacia oleracea) .

  • Functional implications: The structural differences in the small domain and heme-proximal region may contribute to altered redox potential and electron transfer kinetics compared to angiosperm cytochromes.

These structural characteristics reflect the evolutionary position of Cycas as a primitive gymnosperm and provide insights into the adaptation of photosynthetic electron transport components across plant lineages.

What spectroscopic methods are most informative for analyzing Recombinant Cycas taitungensis Apocytochrome f structure and function?

Multiple complementary spectroscopic approaches provide comprehensive structural and functional insights:

  • UV-Visible Spectroscopy:

    • Primary method for assessing heme incorporation and redox state

    • Characteristic peaks at ~410 nm (Soret band), ~520 nm and ~550 nm (α and β bands)

    • Reduced/oxidized difference spectra reveal electron transfer capacity

  • Circular Dichroism (CD):

    • Far-UV CD (190-250 nm): Secondary structure composition (α-helices, β-sheets)

    • Near-UV CD (250-350 nm): Tertiary structure fingerprint and heme environment

    • Thermal melting profiles to determine stability (typically monitor at 222 nm)

  • Fluorescence Spectroscopy:

    • Intrinsic tryptophan fluorescence for tertiary structure assessment

    • Resonance energy transfer measurements for mapping protein-protein interaction distances

  • EPR Spectroscopy:

    • Characterization of the heme iron electronic environment

    • Identification of paramagnetic intermediates during electron transfer

  • NMR Spectroscopy:

    • 1D proton NMR for heme pocket environment

    • 2D HSQC for mapping interaction surfaces with electron transfer partners

These methods collectively provide a comprehensive view of both structural integrity and functional capacity of the recombinant protein, essential for confirming native-like properties.

How can researchers accurately measure the redox potential of Recombinant Cycas taitungensis Apocytochrome f?

Accurate determination of redox potential requires meticulous experimental design:

  • Spectroelectrochemical titration method:

    • Use a thin-layer spectroelectrochemical cell with gold mesh working electrode

    • Employ mediator mixture (typically methyl viologen, benzyl viologen, anthroquinone-2-sulfonate)

    • Monitor absorbance changes at 554 nm during potentiometric titration

    • Apply Nernst equation analysis to titration curves

  • Experimental conditions:

    • Buffer: 50 mM MOPS, pH 7.0, 100 mM NaCl

    • Temperature control at 25 ± 0.1°C

    • Anaerobic environment (oxygen-scrubbed with argon bubbling)

    • Mediator concentrations of 20 μM each

  • Data analysis protocol:

    • Plot percentage reduced cytochrome versus applied potential

    • Fit data to Nernst equation: E = E° + (RT/nF)ln([ox]/[red])

    • Determine midpoint potential (Em) and number of electrons (n)

    • Validate with multiple independent titrations (n≥3)

  • Reference standardization:

    • Calibrate against standard hydrogen electrode (SHE)

    • Include horse heart cytochrome c as internal reference

This methodology enables determination of redox potential with precision of ±5 mV, allowing meaningful comparison with cytochromes f from other species and assessment of environmental factors affecting electron transfer capacity.

What experimental designs best evaluate the electron transfer kinetics of Recombinant Cycas taitungensis Apocytochrome f?

For rigorous evaluation of electron transfer kinetics, implement these methodological approaches:

  • Laser flash photolysis:

    • Sample preparation: 10 μM cytochrome f with 50 μM plastocyanin in 10 mM phosphate buffer (pH 7.0)

    • Excitation: 532 nm laser pulse (5-10 ns duration)

    • Detection: Transient absorption at 554 nm (reduced cytochrome f)

    • Temperature control: Measurements at 10°C intervals from 5-35°C for activation energy determination

  • Stopped-flow spectroscopy:

    • Equal volumes of reduced cytochrome f and oxidized plastocyanin

    • Monitoring at both 554 nm (cytochrome f) and 597 nm (plastocyanin)

    • Measure under varying ionic strength (10-300 mM NaCl) to evaluate electrostatic contributions

    • Data fitting to single or multi-exponential kinetic models

  • Protein immobilization approaches:

    • Self-assembled monolayers on gold electrodes

    • Direct electrochemistry using cyclic voltammetry (scan rate 10-100 mV/s)

    • Chronoamperometry for electron transfer rate determination

  • Data analysis framework:

    • Extract second-order rate constants (typically 106-108 M-1s-1 range)

    • Apply Marcus theory to determine reorganization energy

    • Compare with angiosperm cytochromes to identify gymnosperm-specific kinetic constraints

These complementary approaches provide a comprehensive kinetic profile that reflects the evolutionary adaptations in electron transfer mechanisms in this ancient gymnosperm lineage.

How should contradictory results in functional studies of Recombinant Cycas taitungensis Apocytochrome f be reconciled?

When confronted with contradictory results, implement this systematic reconciliation framework:

  • Protein integrity assessment:

    • Verify intact heme incorporation via UV-visible absorption spectra

    • Confirm proper folding through circular dichroism

    • Assess aggregation state by dynamic light scattering

    • Validate N-terminal sequence to confirm proper processing

  • Experimental parameter standardization:

    • Develop standard operating procedures with detailed buffer compositions

    • Control oxygen exposure during all measurements

    • Standardize protein:detergent ratios in membrane protein preparations

    • Document temperature fluctuations during measurements

  • Statistical analysis approach:

    • Apply hierarchical experimental design with nested factors

    • Use multivariate analysis to identify correlation between variables

    • Implement mixed-effects models to account for batch variability

    • Calculate minimum detectable differences based on observed variability

  • Reconciliation strategy:

    • Identify boundary conditions where results converge

    • Develop testable hypotheses for context-dependent behavior

    • Design critical experiments targeting specific discrepancies

    • Consider protein microheterogeneity as a source of functional diversity

  • Meta-analysis framework:

    • Weight evidence based on methodological rigor

    • Apply Bayesian approaches to update confidence in competing models

    • Incorporate phylogenetic context from other Cycas species

This structured approach transforms contradictory results from obstacles into opportunities for deeper mechanistic understanding of this ancient photosynthetic component.

What are the most appropriate control proteins to include in experimental designs using Recombinant Cycas taitungensis Apocytochrome f?

Rigorous experimental design requires carefully selected controls:

Control TypeRecommended ProteinRationaleKey Parameters to Monitor
Positive phylogenetic controlPinus thunbergii Apocytochrome fClosely related gymnospermRedox potential, electron transfer rates
Negative phylogenetic controlSpinacia oleracea Apocytochrome fDistantly related angiospermInteraction specificity, evolutionary divergence
Structural controlSite-directed mutant (H202A)Disrupted heme coordinationSpectral properties, folding stability
Functional controlPlastocyanin from same speciesNatural electron acceptorBinding kinetics, complex formation
Expression system controlNon-recombinant native proteinAssess expression artifactsPost-translational modifications, activity comparison
Technical controlHorse heart cytochrome cWell-characterized referenceStandard for spectroscopic measurements

For each control, maintain identical buffer conditions, protein concentrations, and analytical methods to ensure valid comparisons. Document batch-to-batch variation in control proteins to establish normal variability ranges. This comprehensive control strategy enables confident attribution of observed effects to the specific properties of C. taitungensis Apocytochrome f rather than experimental artifacts or general cytochrome characteristics.

How do post-translational modifications affect the functional properties of Recombinant Cycas taitungensis Apocytochrome f?

Post-translational modifications (PTMs) significantly impact functional properties of Recombinant C. taitungensis Apocytochrome f:

  • Heme attachment:

    • Critical CXXCH motif requires proper thioether bond formation

    • In bacterial expression systems, supplementation with δ-aminolevulinic acid increases proper heme incorporation from 65% to >90%

    • Incomplete heme attachment creates heterogeneous preparations with altered spectral properties

  • N-terminal processing:

    • Removal of transit peptide affects protein stability and redox potential

    • Bacterial systems may produce mixed populations with variable N-termini

    • Mass spectrometry analysis essential to confirm processing accuracy

  • Comparison across expression systems:

    Expression SystemHeme IncorporationN-terminal ProcessingGlycosylationFunctional Impact
    E. coli65-90%Often incompleteAbsentReduced stability, altered Em
    Yeast80-95%Mostly correctMinimalNear-native activity
    Insect cells>95%CorrectPresentNative-like kinetics
    Plant cells>98%CorrectNative patternFull functionality
  • Analytical approaches:

    • Mass spectrometry-based PTM mapping

    • Site-directed mutagenesis to assess PTM importance

    • Comparative spectroscopy across expression systems

The functional consequences of accurate PTMs include 15-25% higher electron transfer rates, 2-3 fold improvement in stability, and proper interaction with partner proteins like plastocyanin.

What are the evolutionary implications of studying Recombinant Cycas taitungensis Apocytochrome f as a representative of an ancient gymnosperm lineage?

Studying C. taitungensis Apocytochrome f provides valuable evolutionary insights:

  • Photosynthetic electron transport evolution:

    • Cycas represents an ancient gymnosperm lineage with origins dating back >250 million years

    • Comparative analysis with ferns, angiosperms, and other gymnosperms reveals selective pressures on photosynthetic efficiency

    • Sequence conservation patterns identify functional constraints maintained across evolutionary time

  • Organellar gene transfer patterns:

    • In some plant species, chloroplast genes like petA have been found in mitochondrial genomes

    • For example, Phoenix dactylifera (date palm) contains chloroplast-derived sequences including intact petA in its mitochondrial genome

    • Analysis of C. taitungensis can elucidate timing and mechanism of such transfers in gymnosperm lineages

  • Adaptation to environmental conditions:

    • Cycads evolved under different atmospheric CO₂ conditions

    • Structural adaptations in electron transport proteins reflect ancient environmental pressures

    • Redox potential shifts compared to angiosperms reveal evolutionary tuning of photosynthetic efficiency

  • Methodological implications:

    • Establishing robust expression systems for gymnosperm proteins creates research tools for studying other ancient photosynthetic components

    • Challenges in recombinant production reveal evolutionary constraints on protein structure that inform directed evolution studies

This research contributes to understanding photosynthesis evolution across >400 million years of plant adaptation, with implications for engineering improved photosynthetic efficiency in crops.

How can molecular dynamics simulations enhance understanding of Recombinant Cycas taitungensis Apocytochrome f structure-function relationships?

Molecular dynamics (MD) simulations provide critical insights that complement experimental approaches:

  • Simulation preparation protocol:

    • Homology model development using Pinus as template (if crystal structure unavailable)

    • Explicit solvent environment with TIP3P water model

    • CHARMM36 force field with specialized heme parameters

    • System size ~100,000 atoms including 150 mM NaCl

  • Simulation regimes:

    • Equilibration: 10 ns with gradual restraint release

    • Production: Minimum 500 ns trajectory (multiple replicates)

    • Enhanced sampling: Replica exchange or metadynamics for energy landscape exploration

  • Analysis methodologies:

    • Root mean square fluctuation (RMSF) to identify dynamic regions

    • Principal component analysis for essential motion identification

    • Hydrogen bond network analysis around heme pocket

    • Electrostatic surface calculation for interaction interface mapping

    • Water density analysis for hydration patterns

  • Functional insights obtainable:

    • Plastocyanin docking pathway identification

    • Conformational changes during electron transfer

    • Allosteric communication networks within protein

    • Effects of membrane environment on protein dynamics

    • Comparison with angiosperm homologs to identify gymnosperm-specific dynamics

  • Integration with experimental data:

    • Validate simulations against NMR chemical shift data

    • Test predictions through site-directed mutagenesis

    • Use simulation-derived hypotheses to guide spectroscopic studies

These computational approaches reveal dynamic properties inaccessible to static structural methods, providing mechanistic understanding of electron transfer and evolutionary adaptation in this ancient photosynthetic component.

What are the most authoritative reference materials for researchers working with Recombinant Cycas taitungensis Apocytochrome f?

Researchers should consult these authoritative references organized by research focus:

  • Evolutionary context:

    • Comparative studies of mitochondrial genomes across plant lineages

    • Phylogenetic analyses of cytochrome b6f components in gymnosperms

    • Studies on chloroplast-derived sequences in plant mitochondrial genomes

  • Structural biology resources:

    • Crystal structures of cytochrome f from model organisms

    • NMR studies of cytochrome dynamics and interaction surfaces

    • Computational models of electron transfer complexes

  • Methodological references:

    • Protocols for gymnosperm protein expression optimization

    • Purification strategies for membrane-associated proteins

    • Spectroscopic methods for heme protein characterization

  • Databases and repositories:

    • UniProt entries for annotated Cycas proteins

    • Chloroplast genome databases with comparative petA sequences

    • Protein Data Bank entries for related cytochrome structures

  • Commercial resources:

    • Specialized expression vectors for challenging proteins

    • Purification systems optimized for heme-containing proteins

    • Reference proteins for standardization of measurements

Regular monitoring of new publications in plant biochemistry, photosynthesis research, and gymnosperm genomics is essential for maintaining current knowledge in this specialized research area.

What standardized reporting protocols should be followed when publishing research on Recombinant Cycas taitungensis Apocytochrome f?

Adherence to standardized reporting enables reproducibility and cross-study comparison:

  • Expression system documentation:

    • Complete vector sequence including all regulatory elements

    • Detailed host strain genotype and growth conditions

    • Induction parameters (temperature, duration, inducer concentration)

    • Cell lysis method and buffer composition

  • Protein characterization requirements:

    • Mass spectrometry confirmation of intact mass and N-terminus

    • UV-visible spectroscopy with extinction coefficients

    • Circular dichroism spectra (raw data in mdeg, not just percentages)

    • Purity assessment by multiple methods (SDS-PAGE, SEC, DLS)

  • Functional assay standardization:

    • Detailed buffer compositions including all additives

    • Temperature control protocols

    • Statistical analysis methods including sample sizes

    • Raw kinetic data alongside fitted parameters

  • Computational protocols:

    • Model building methodology with template justification

    • Force field parameters especially for heme

    • Sampling adequacy metrics

    • Data availability in community repositories

  • Negative results reporting:

    • Failed expression strategies

    • Unsuccessful purification approaches

    • Contradictory findings with possible explanations

These reporting standards align with broader initiatives in biochemistry and structural biology to enhance reproducibility while addressing the specific challenges of working with proteins from non-model organisms like Cycas taitungensis.

Citations Fang Y, Wu H, Zhang T, Yang M, Yin Y, Pan L, et al. A Complete Sequence and Transcriptomic Analyses of Date Palm (Phoenix dactylifera L.) Mitochondrial Genome. PLoS ONE 7(5): e37164, 2012. We used transcriptome data from bud, root, seed, fruit, male and female flowers, yellow and green leaves of cultivar Khalas. The mt genome of P. dactylifera encodes 38 proteins, 30 tRNAs, and 3 ribosomal RNAs. GeneBio Systems. Protein antigens collection including Recombinant Apocytochrome f (petA) from various species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.