Recombinant Cycas taitungensis Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
cemA; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Cycas taitungensis (Prince sago) (Cycas taiwaniana)
Target Names
cemA
Target Protein Sequence
MAKYKALASLRYLACLVFLPWGISISFQKGLEPWVTNWWNTGQSREFSDYLQEENALERF GEIEELFLLERMVEDSSETHSQDLRIEIRKKTIQLVEMYNEDLIQIISHLLANFICFATP GAYFILGKEKLVVLNSWIQELFHSLSDTMKAFSILLVTDLCIGFHSPHGWELMIDSISEN YGFSHDEQRISGLVSTFPVISDTIFKYWIFRHLNRISPSLVVIYHSMNE
Uniprot No.

Target Background

Function
This protein may be involved in proton extrusion and indirectly facilitates efficient inorganic carbon uptake into chloroplasts.
Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of the cemA gene in Cycas taitungensis?

The cemA gene is located in the plastid genome (plastome) of Cycas taitungensis. Like other cycad species, the C. taitungensis plastome exhibits a conserved structure with consistent gene content when compared with related species such as C. debaoensis . The gene is part of the core set of plastid genes maintained throughout the evolutionary history of cycads. While specific studies on cemA were not directly reported in the search results, plastome analysis in Cycas species revealed stability in gene content across the genus, suggesting cemA would maintain consistent presence and position within the genome .

Methodological approach: To accurately determine cemA positioning and context, researchers should perform complete plastome sequencing using a combination of next-generation sequencing platforms (Illumina paired-end reads) and long-read technologies (Nanopore) to ensure accurate assembly, following protocols similar to those used for C. debaoensis . Annotation can be performed using tools like GeSeq or the PGA pipeline with manual curation in Geneious .

How does the cemA protein from Cycas taitungensis compare structurally to cemA proteins from other plant species?

While specific structural comparisons of cemA across species were not directly mentioned in the search results, evolutionary analyses of plastid protein-coding genes in Cycas have shown that most are under purifying selection, with only a few exceptions like ndhB showing different evolutionary patterns . This suggests cemA likely maintains structural conservation due to functional constraints.

Methodological approach: To analyze cemA structure across species, researchers should:

  • Extract the cemA coding sequences from multiple sequenced plastomes

  • Perform multiple sequence alignment using MUSCLE or MAFFT

  • Calculate nonsynonymous (dN) and synonymous (dS) substitution rates using PAML

  • Construct protein models using I-TASSER or AlphaFold

  • Compare structural predictions to identify conserved domains and species-specific differences

What expression systems are most effective for producing recombinant Cycas taitungensis cemA protein?

Methodological approach: A systematic comparison of expression systems is recommended:

Expression SystemAdvantagesChallengesRecommended Protocol
E. coli (BL21)High yield, cost-effectiveMay form inclusion bodiesUse fusion tags (MBP, SUMO); express at lower temperatures (16-20°C)
E. coli C41/C43Specialized for membrane proteinsLower yields than standard strainsInduce with low IPTG concentrations (0.1-0.5 mM)
Yeast (P. pastoris)Post-translational modificationsLonger expression timeMethanol induction protocol with secretion signals
Insect cellsComplex folding capabilityHigher cost, technical complexityBaculovirus expression vector system (BEVS)

Initial expression trials should begin with E. coli C41/C43 strains using a construct containing an N-terminal His6-tag and a C-terminal StrepII-tag for tandem affinity purification. Optimization of induction time, temperature, and detergent selection will be critical for obtaining functional protein.

What are the most effective solubilization strategies for cemA as a chloroplast membrane protein?

As a chloroplast envelope membrane protein, cemA presents challenges for solubilization and purification while maintaining native conformation.

Methodological approach: A systematic screening of detergents and solubilization conditions is essential:

  • First attempt: Mild non-ionic detergents (DDM, LMNG, or digitonin) at concentrations just above their critical micelle concentration

  • Second approach: Use of amphipols or nanodiscs for membrane protein stabilization

  • Alternative strategy: Cell-free expression systems with direct incorporation into liposomes

For initial purification, solubilize membrane fractions in buffer containing 20 mM Tris-HCl pH 8.0, 150 mM NaCl, 5% glycerol, and 1% DDM for 1 hour at 4°C, followed by ultracentrifugation to remove insoluble material. The supernatant can then be subjected to affinity chromatography using the introduced tags.

What assays can effectively measure the functional activity of recombinant cemA protein?

Though specific cemA functions remain incompletely characterized, its role as a chloroplast envelope membrane protein suggests involvement in envelope-related processes.

Methodological approach: Multiple complementary functional assays should be employed:

  • Liposome reconstitution assays to measure potential ion transport activity

  • Protein-protein interaction studies using pull-down assays and co-immunoprecipitation

  • Complementation of cyanobacterial mutants lacking cemA homologs

  • In vitro reconstitution with potential interaction partners from the chloroplast envelope

  • Patch-clamp electrophysiology when incorporated into giant unilamellar vesicles (GUVs)

Establish baseline measurements using wild-type protein, then compare with site-directed mutants to identify functionally important residues.

How do post-translational modifications affect cemA function in Cycas taitungensis?

While the search results do not specifically address post-translational modifications (PTMs) of cemA, plastid proteins may undergo various modifications that affect their function.

Methodological approach: To characterize PTMs:

  • Perform mass spectrometry analysis of native cemA isolated from C. taitungensis chloroplasts

  • Compare with recombinant protein expressed in different systems

  • Use phosphoproteomic approaches to identify potential phosphorylation sites

  • Apply site-directed mutagenesis to modify potential PTM sites and evaluate functional consequences

  • Conduct comparative analyses with cemA proteins from model plant species where PTM data is available

How has the cemA gene evolved across Cycas species, and what does this reveal about functional constraints?

Evolutionary analyses of plastid genes in Cycas have shown predominantly purifying selection , suggesting functional constraints on these genes. A comprehensive analysis of cemA evolution would provide insights into its functional importance.

Methodological approach:

  • Extract cemA sequences from available Cycas plastomes representing all six sections

  • Perform phylogenetic analysis using maximum likelihood and Bayesian approaches

  • Calculate dN/dS ratios to identify selection patterns across the phylogeny

  • Map amino acid substitutions onto predicted protein structures

  • Compare with cemA evolution patterns in other gymnosperm and angiosperm lineages

The analysis should include calculation of site-specific selection pressures to identify functionally important domains within the protein.

Does cemA exhibit phylogenetic discordance compared to other plastid genes in Cycas?

The search results indicate that some plastid genes in Cycas show phylogenetic discordance , but cemA was not specifically mentioned. Analyzing whether cemA follows the predominant plastome phylogenetic signal or shows discordance would provide insights into its evolutionary history.

Methodological approach:

  • Construct individual gene trees for cemA and other plastid genes

  • Compare topologies using Robinson-Foulds distances and quartet-based metrics

  • Apply coalescent methods (ASTRAL-III) to account for incomplete lineage sorting

  • Perform bipartition analysis using PhyParts to quantify gene tree conflict

  • Visualize discordance using pie charts showing percentages of concordance and conflict

What strategies can be employed to investigate cemA protein-protein interactions within the chloroplast envelope?

Understanding the interaction network of cemA is crucial for elucidating its function in the chloroplast envelope.

Methodological approach:

  • Proximity-based labeling approaches (BioID or APEX) with cemA as the bait protein

  • Co-immunoprecipitation followed by mass spectrometry identification of interaction partners

  • Yeast two-hybrid or split-ubiquitin membrane yeast two-hybrid screening

  • Förster resonance energy transfer (FRET) with fluorescently tagged cemA and candidate interactors

  • Cross-linking mass spectrometry to capture transient interactions

Create an interaction map that includes both direct binding partners and components of larger complexes, with verification through reciprocal pull-downs.

How can CRISPR/Cas technologies be applied to study cemA function in model systems?

While direct genetic manipulation of Cycas taitungensis is challenging due to its slow growth and limited transformation protocols, CRISPR/Cas approaches can be applied in model systems.

Methodological approach:

  • Express C. taitungensis cemA in model species (Arabidopsis, tobacco) with native cemA knockout

  • Design sgRNAs targeting conserved regions of cemA for CRISPR/Cas9 editing

  • Generate domain-specific deletions to map functional regions

  • Create chimeric proteins combining domains from cemA orthologs across species

  • Perform base editing to introduce specific mutations identified in evolutionary analyses

This approach allows functional testing of C. taitungensis cemA in tractable model systems while maintaining relevance to the native protein.

What are the optimal conditions for obtaining high-resolution structural data for cemA?

As a membrane protein, cemA presents significant challenges for structural determination. A multi-technique approach is necessary to maximize chances of success.

Methodological approach:

  • X-ray crystallography:

    • Screen multiple constructs with varying terminal truncations

    • Test fusion partners that facilitate crystallization (T4 lysozyme, BRIL)

    • Employ lipidic cubic phase crystallization methods

  • Cryo-electron microscopy:

    • Reconstitute in nanodiscs or amphipols to increase particle size

    • Consider fusion with megabody scaffolds to aid in particle orientation

    • Implement GraFix method to stabilize potential complexes

  • Nuclear magnetic resonance:

    • Produce isotopically labeled protein (13C, 15N) in E. coli

    • Consider selective labeling of specific amino acids

    • Perform solution NMR for soluble domains and solid-state NMR for membrane-embedded regions

How can molecular dynamics simulations complement experimental approaches to understanding cemA structure and function?

Computational approaches provide valuable insights when experimental structural data is limited.

Methodological approach:

  • Generate homology models based on structural predictions from AlphaFold2

  • Embed models in simulated lipid bilayers matching chloroplast envelope composition

  • Perform all-atom molecular dynamics simulations (300-500 ns) to assess stability

  • Apply enhanced sampling techniques (metadynamics, umbrella sampling) to explore conformational changes

  • Simulate potential substrate binding and movement through predicted channels or binding sites

  • Calculate free energy profiles for hypothesized transport mechanisms

The results from computational simulations can guide experimental design by identifying critical residues for mutagenesis and suggesting potential functions for experimental validation.

How might comparative studies across cycad species inform our understanding of cemA evolution and function?

The search results indicate significant research on Cycas plastome evolution across species , providing a foundation for cemA-specific comparative studies.

Methodological approach:

  • Sequence and compare cemA genes from diverse cycad species representing all major lineages

  • Correlate sequence variations with environmental adaptations and phylogenetic relationships

  • Identify conserved regions that suggest functional importance

  • Express and characterize cemA from multiple cycad species to identify functional differences

  • Correlate molecular evolution patterns with species diversification events

Such comparisons would provide insights into how cemA function may have adapted across cycad evolution and potentially identify specialized functions in certain lineages.

What novel biotechnological applications might emerge from research on Cycas taitungensis cemA?

While maintaining focus on academic rather than commercial applications, understanding cemA function could lead to valuable biotechnological tools.

Methodological approach for potential applications:

  • Explore cemA as a potential targeting sequence for chloroplast envelope localization in transgenic plants

  • Investigate cemA-derived peptides as potential modulators of envelope permeability

  • Develop cemA-based biosensors for monitoring chloroplast envelope integrity

  • Engineer cemA variants with enhanced or modified functions for plant improvement

  • Utilize structural insights from cemA to design synthetic membrane proteins with novel functions

These applications remain in the realm of basic research but highlight potential future directions for cemA studies beyond evolutionary and functional characterization.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.