Recombinant Cycas taitungensis NAD (P)H-quinone oxidoreductase subunit 6, chloroplastic

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it when placing your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timelines.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice shipping is required, please communicate this need in advance as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. The shelf life of lyophilized forms is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ndhG; NAD(PH-quinone oxidoreductase subunit 6, chloroplastic; NAD(PH dehydrogenase subunit 6; NADH-plastoquinone oxidoreductase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-180
Protein Length
full length protein
Species
Cycas taitungensis (Prince sago) (Cycas taiwaniana)
Target Names
ndhG
Target Protein Sequence
MDLPGPIRDILLVPLELGLILGGLEVVLLTNIIYSALSLGPVLVCISLLYILLNADFVAA AQILIYVGAVNVLIVFAVMLMNNQKYPNFVPLWTVGDGITLVVCTSLFCSLITIILNTSW SEISMTTKSNQILEQDLTNNVQRIGAHLSTDFFLPFELLSIILLVALVGAITIARREEIV
Uniprot No.

Target Background

Function
NDH facilitates electron transfer from NAD(P)H:plastoquinone, through FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic chain and potentially a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. It couples the redox reaction with proton translocation, effectively conserving redox energy in a proton gradient.
Protein Families
Complex I subunit 6 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

How does the chloroplastic NAD(P)H-quinone oxidoreductase function in Cycas taitungensis?

The chloroplastic NAD(P)H-quinone oxidoreductase in Cycas taitungensis catalyzes the transfer of electrons from NAD(P)H to plastoquinone in the thylakoid membrane. This enzyme participates in cyclic electron flow around photosystem I, which generates additional ATP without producing NADPH. The reaction can be represented as:

NAD(P)H + H⁺ + plastoquinone → NAD(P)⁺ + plastoquinol

This process is particularly important under stress conditions when additional ATP is required. The subunit 6 (ndhG) forms part of the membrane domain of this complex and is involved in quinone binding and reduction . Unlike its mitochondrial homologs, the chloroplastic enzyme operates within the unique environment of the thylakoid membrane, coordinating with photosynthetic electron transport .

What is the evolutionary significance of the ndhG gene in Cycas taitungensis?

The ndhG gene in Cycas taitungensis represents an important evolutionary marker in gymnosperms. Phylogenomic analyses reveal that Cycas, as one of the most ancient extant seed plants, maintains a complete set of ndh genes in its chloroplast genome, unlike some other gymnosperms that have lost these genes .

Analysis of nucleotide substitution rates shows that ndhG has been under purifying selection (dN/dS < 1), indicating its functional importance has been conserved throughout evolution. Comparative studies across different Cycas species show that while most plastid protein-coding genes have been under purifying selection, the ndh gene family, including ndhG, displays relatively higher nonsynonymous (dN) rates compared to genes directly involved in photosynthesis such as those encoding ATP synthase, cytochrome b6f complex, and photosystems I and II .

What are the optimal conditions for expression and purification of recombinant Cycas taitungensis NAD(P)H-quinone oxidoreductase subunit 6?

Expression System Selection:
The recombinant expression of membrane proteins like NAD(P)H-quinone oxidoreductase subunit 6 requires careful consideration of expression systems. For this chloroplastic protein, E. coli-based expression systems with modifications for membrane protein expression are recommended.

Optimization Protocol:

  • Clone the ndhG gene into a vector containing a strong inducible promoter (T7 or tac)

  • Transform into E. coli strains specialized for membrane protein expression (C41(DE3) or C43(DE3))

  • Grow cultures at 30°C until OD600 reaches 0.6-0.8

  • Induce with 0.1-0.5 mM IPTG

  • Lower temperature to 18-20°C post-induction

  • Continue expression for 16-20 hours

Purification Strategy:

  • Cell lysis using detergent-based buffer (20 mM Tris-HCl pH 8.0, 150 mM NaCl, 1% DDM)

  • Affinity chromatography using Ni-NTA for His-tagged protein

  • Size exclusion chromatography in buffer containing 0.05% DDM

Storage Conditions:
Store in Tris-based buffer with 50% glycerol at -20°C for short-term or -80°C for extended storage. Avoid repeated freeze-thaw cycles and maintain working aliquots at 4°C for up to one week .

How can the enzymatic activity of recombinant Cycas taitungensis NAD(P)H-quinone oxidoreductase be measured accurately?

Enzymatic Assay Principles:
The activity of NAD(P)H-quinone oxidoreductase can be measured spectrophotometrically by monitoring the oxidation of NAD(P)H at 340 nm or by following the reduction of various quinone substrates.

Standard Assay Protocol:

  • Prepare reaction buffer: 50 mM Tris-HCl (pH 7.5), 0.1% Triton X-100

  • Add 100-200 μM NAD(P)H as electron donor

  • Add 50-100 μM quinone substrate (e.g., duroquinone or plastoquinone)

  • Initiate reaction by adding 1-5 μg purified enzyme

  • Monitor decrease in absorbance at 340 nm (ε = 6,220 M⁻¹cm⁻¹) for NAD(P)H oxidation

  • Calculate activity using the formula:
    Activity (μmol/min/mg) = (ΔA340/min × reaction volume)/(6.22 × enzyme amount in mg)

Substrate Specificity Assessment:
To determine substrate preference, compare reaction rates with different quinones:

  • Plastoquinone (natural substrate)

  • Duroquinone (2,3,5,6-tetramethyl-p-benzoquinone)

  • Benzoquinone

  • 9,10-phenanthrenequinone

Inhibition Studies:
Use specific inhibitors to validate assay specificity:

  • Dicoumarol (10-100 μM)

  • Antimycin A (5-50 μM)

  • Rotenone (5-50 μM)

What challenges are associated with expressing chloroplastic membrane proteins and how can they be overcome?

Key Challenges:

  • Membrane Integration: Chloroplastic membrane proteins require proper insertion into membranes for correct folding and function.

  • Cofactor Association: NAD(P)H-quinone oxidoreductases require FAD cofactor binding for activity.

  • Protein Toxicity: Overexpression of membrane proteins can be toxic to host cells.

  • Protein Aggregation: Tendency to form inclusion bodies in heterologous expression systems.

Solution Strategies:

  • Fusion Tags Selection:

    • N-terminal fusion with MBP (maltose-binding protein) to enhance solubility

    • C-terminal His6 tag for purification

    • Avoid bulky tags that might interfere with membrane integration

  • Expression Host Optimization:

    • Use C41(DE3) or C43(DE3) E. coli strains designed for membrane protein expression

    • Consider green algae-based expression systems for chloroplastic proteins

  • Solubilization and Stabilization:

    • Screen multiple detergents (DDM, LDAO, OG) for optimal solubilization

    • Include glycerol (10-20%) to stabilize protein structure

    • Add FAD (5-10 μM) during purification to ensure cofactor association

  • Refolding Protocol:
    If inclusion bodies form, implement this refolding strategy:

    • Solubilize inclusion bodies in 8M urea or 6M guanidine-HCl

    • Perform step-wise dialysis with decreasing denaturant concentration

    • Include 0.1-0.5% detergent and 5 μM FAD during refolding

    • Monitor refolding by activity assays at each step

How does the structure-function relationship in Cycas taitungensis NAD(P)H-quinone oxidoreductase compare to homologous enzymes in other species?

The structure-function relationship in Cycas taitungensis NAD(P)H-quinone oxidoreductase reveals important evolutionary adaptations compared to homologs in other organisms. Comparative analysis shows several key differences:

Structural Comparisons Across Species:

FeatureCycas taitungensis (Gymnosperm)Human NQO1Plant Mitochondrial Complex IBacterial NDH Complex
Cofactor bindingHigh affinity for both NADH and NADPHPreference for NADPHNADH specificSpecies-dependent
Active site architectureContains conserved tyrosine involved in quinone bindingTyr-128 and 232-236 loop close binding siteMore enclosed quinone binding pocketMore exposed binding site
Electron transfer mechanismDirect hydride transferPing-pong mechanism with flavin intermediateMulti-step electron transfer chainSimilar to chloroplast complex
Substrate specificityPlastoquinone preferenceWide range of quinonesUbiquinone specificVariable

The chloroplastic NAD(P)H-quinone oxidoreductase in Cycas taitungensis has evolved specific adaptations for functioning in the unique environment of the chloroplast. Unlike human NQO1, which has a primary role in detoxification, the Cycas enzyme is integrated into photosynthetic electron transport.

Key structural differences include the absence of zinc-binding motifs seen in some alcohol dehydrogenases, and the presence of specific amino acid substitutions in the NADPH-binding pocket. These substitutions affect the orientation of the adenine ring of NADPH, potentially contributing to the dual specificity for both NADH and NADPH observed in plant enzymes .

What is the role of NAD(P)H-quinone oxidoreductase in stress response and adaptation mechanisms in Cycas taitungensis?

NAD(P)H-quinone oxidoreductase plays a critical role in stress adaptation in Cycas taitungensis through several interconnected mechanisms:

Oxidative Stress Protection:
The enzyme catalyzes obligatory two-electron reduction of quinones to hydroquinones, preventing the formation of reactive semiquinone intermediates that would occur during one-electron reduction pathways. This mechanism effectively reduces oxidative damage by:

  • Detoxifying quinones before they can participate in redox cycling

  • Preventing the generation of reactive oxygen species

  • Maintaining cellular redox homeostasis during environmental stress

Cyclic Electron Flow Regulation:
Under stress conditions such as drought, high light intensity, or temperature extremes, the chloroplastic NAD(P)H-quinone oxidoreductase contributes to enhanced cyclic electron flow around photosystem I, which:

  • Generates additional ATP without producing excess reducing equivalents

  • Protects photosystem I from photodamage through controlled electron dissipation

  • Maintains the pH gradient across the thylakoid membrane

Molecular Evidence of Stress Adaptation:
Genomic analysis of Cycas taitungensis has identified six positively selected genes involved in stress responses, suggesting environmental adaptation has played an important role in the evolution of this ancient gymnosperm. The NAD(P)H-quinone oxidoreductase complex exhibits regulatory adaptations that allow it to respond to:

  • Light intensity fluctuations

  • Temperature variations

  • Water availability changes

This is particularly significant for Cycas species, which have survived as "living fossils" through numerous climate changes over evolutionary time .

How can site-directed mutagenesis be applied to investigate the catalytic mechanism of Cycas taitungensis NAD(P)H-quinone oxidoreductase?

Site-directed mutagenesis represents a powerful approach to dissect the catalytic mechanism of Cycas taitungensis NAD(P)H-quinone oxidoreductase. Based on structural insights from homologous enzymes, the following comprehensive mutagenesis strategy can be implemented:

Key Residues for Mutagenesis:

  • NAD(P)H Binding Site:

    • Conserved glycine residues that interact with the pyrophosphate moiety

    • Tyrosine residues involved in stacking against the adenine ring

    • Key residues specific to the mirrored orientation of NADPH observed in some species

  • FAD Binding Site:

    • Residues that coordinate the isoalloxazine ring of FAD

    • Amino acids involved in stabilizing the ribose and phosphate groups

  • Quinone Binding Pocket:

    • Residues lining the potential quinone-binding channel

    • Amino acids positioned to facilitate direct hydride transfer

    • Hydrophobic residues that may contribute to substrate specificity

Experimental Approach:

  • Alanine Scanning:

    • Systematically replace conserved residues with alanine

    • Measure effects on substrate binding (Km) and catalytic efficiency (kcat)

  • Conservative Substitutions:

    • Replace key residues with chemically similar amino acids

    • Assess the importance of specific chemical properties

  • Cross-Species Substitutions:

    • Introduce residues from other species (human, bacterial)

    • Determine if catalytic properties can be altered to resemble other homologs

Analysis Methods:

Based on studies of homologous enzymes, mutations of the residues corresponding to Tyr-128 and the loop spanning residues 232-236 would be particularly informative, as these regions close the binding site and partially occupy the space left vacant by departing substrate or cofactor molecules during the catalytic cycle .

What is the significance of studying Cycas taitungensis NAD(P)H-quinone oxidoreductase in understanding gymnosperm evolution?

Studying the NAD(P)H-quinone oxidoreductase complex in Cycas taitungensis provides unique insights into gymnosperm evolution for several compelling reasons:

Evolutionary Conservation and Divergence:
Cycas represents one of the most ancient extant seed plant lineages and retains a complete set of ndh genes in its chloroplast genome. Comprehensive phylogenomic analyses reveal that while some gymnosperms (particularly conifers) have lost these genes, Cycas maintains them, suggesting they serve important functions that have been preserved over hundreds of millions of years of evolution.

Molecular Clock Evidence:
The ndhG gene in Cycas taitungensis shows distinctive evolutionary patterns:

  • Relatively higher nonsynonymous (dN) substitution rates compared to genes directly involved in photosynthesis

  • Evidence of purifying selection (dN/dS < 1), indicating functional constraints

  • Section-specific evolutionary rates, with the Stangerioides section showing significantly lower dN/dS values than sympatric Asiorientales and Indosinenses sections

Genomic Context:
Analysis of the complete chloroplast genome of Cycas taitungensis reveals important structural features:

  • The presence of all 11 ndh genes (ndhA-K) encoded in the chloroplast genome

  • Conservation of gene order and arrangement similar to other ancient plant lineages

  • RNA editing sites that are conserved across distant plant lineages, indicating ancient regulatory mechanisms

This research provides evidence for the "living fossil" status of Cycas and offers insights into how photosynthetic electron transport mechanisms have evolved in seed plants. The maintenance of the complete ndh complex in Cycas while it has been lost in some other gymnosperm lineages suggests that there may be specific ecological or physiological adaptations in Cycas that rely on this complex .

How can understanding the structure and function of Cycas taitungensis NAD(P)H-quinone oxidoreductase contribute to biotechnological applications?

The structural and functional insights from Cycas taitungensis NAD(P)H-quinone oxidoreductase offer several promising biotechnological applications:

Bioremediation Technologies:
The enzyme's ability to reduce quinones can be harnessed for environmental applications:

  • Detoxification of quinone pollutants in contaminated soils and waters

  • Transformation of quinone-based industrial waste products

  • Development of biosensors for quinone detection in environmental samples

Stress-Tolerant Crop Development:
Understanding the role of NAD(P)H-quinone oxidoreductase in stress adaptation can inform genetic engineering approaches:

  • Enhancement of cyclic electron flow in crop plants to improve drought tolerance

  • Engineering improved photoprotection mechanisms for high-light environments

  • Development of crops with enhanced antioxidant capabilities

Drug Development and Activation:
The enzyme's catalytic mechanism can be exploited for pharmaceutical applications:

  • Activation of quinone-based prodrugs specific to tissues expressing engineered variants

  • Development of anticancer compounds that utilize NAD(P)H-quinone oxidoreductase for selective cytotoxicity

  • Creation of novel antibiotics targeting pathogen-specific quinone reductases

Enzyme Engineering for Biocatalysis:
The unique dual specificity for NADH and NADPH makes this enzyme an attractive target for biocatalytic applications:

  • Development of improved biocatalysts for asymmetric reduction reactions

  • Creation of enzyme variants with altered substrate specificities

  • Engineering of thermostable variants for industrial biocatalysis

A particularly promising application derives from studies showing that quinone oxidoreductases can convert aziridinyl-substituted quinone compounds into potent alkylating agents. This property is already being explored for targeted cancer therapies, and insights from the ancient and stable Cycas enzyme could contribute to developing more effective and selective anticancer agents .

What analytical techniques are most effective for characterizing the protein-protein interactions within the NAD(P)H-quinone oxidoreductase complex?

Characterizing protein-protein interactions within the multi-subunit NAD(P)H-quinone oxidoreductase complex requires an integrated analytical approach combining multiple complementary techniques:

Structural Techniques:

Biochemical and Biophysical Methods:

  • Co-immunoprecipitation with Tagged Subunits:

    • Strategy: Express tagged versions of individual subunits

    • Analysis: Identify interacting partners by mass spectrometry

    • Quantification: Determine interaction stoichiometry

  • Surface Plasmon Resonance (SPR) and Biolayer Interferometry (BLI):

    • Application: Measure binding kinetics between isolated subunits

    • Advantages: Real-time monitoring of association/dissociation

    • Data analysis: Fit to appropriate binding models (1:1, heterogeneous ligand)

  • Native Mass Spectrometry:

    • Approach: Analyze intact complexes under native conditions

    • Information obtained: Stoichiometry, stability, and architecture of subcomplexes

    • Advantage: Can resolve compositionally heterogeneous complexes

Functional Analysis Techniques:

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Principle: Measures solvent accessibility of protein regions

    • Application: Identify binding interfaces between subunits

    • Analysis: Compare exchange rates in isolated subunits versus intact complex

  • Förster Resonance Energy Transfer (FRET):

    • Application: Measure distances between fluorescently labeled subunits

    • Advantages: Can be performed in native membranes

    • Analysis: Calculate apparent FRET efficiencies to determine proximity

  • Electron Paramagnetic Resonance (EPR) Spectroscopy:

    • Approach: Site-directed spin labeling of key residues

    • Advantage: Provides information about dynamic interactions

    • Application: Map conformational changes during catalytic cycle

By integrating data from these complementary approaches, researchers can build comprehensive models of subunit interactions and dynamic changes during the catalytic cycle of the NAD(P)H-quinone oxidoreductase complex .

How can researchers overcome challenges in obtaining active recombinant Cycas taitungensis NAD(P)H-quinone oxidoreductase subunit 6?

Obtaining active recombinant chloroplastic membrane proteins presents numerous challenges. Here's a systematic troubleshooting approach specific to Cycas taitungensis NAD(P)H-quinone oxidoreductase subunit 6:

Expression Troubleshooting:

ChallengeLikely CauseSolution Strategy
Low expression levelCodon biasOptimize codons for expression host; use Rosetta or similar strains
Promoter leakageUse tighter control systems (e.g., pLysS strains)
Protein toxicityUse lower induction temperature (16-18°C) and reduced IPTG concentration (0.1 mM)
Inclusion body formationImproper membrane integrationCo-express with chaperones (GroEL/ES, DnaK/J)
Rapid expression rateUse auto-induction media instead of IPTG induction
Incorrect folding environmentConsider cell-free expression systems with added lipids or nanodiscs

Purification Troubleshooting:

  • Solubilization Optimization:

    • If protein is in inclusion bodies, screen solubilization buffers systematically:

      • Test different detergents: DDM, LDAO, Fos-choline-12

      • Try different detergent concentrations (0.5-2%)

      • Vary buffer compositions (pH 6.5-8.0)

      • Include stabilizing additives (glycerol, arginine)

  • Affinity Purification Challenges:

    • For poor binding to affinity resin:

      • Ensure tag is accessible (not buried in micelles)

      • Consider dual tagging approaches (N-terminal His, C-terminal FLAG)

      • Use longer linkers between protein and tag

    • For co-purification of contaminants:

      • Increase imidazole in wash buffers (30-50 mM)

      • Add additional wash steps with salt gradients

  • Activity Recovery:

    • If purified protein lacks activity:

      • Add lipids during purification (DOPC, POPE)

      • Supplement with FAD cofactor (5-10 μM)

      • Include reducing agents (DTT, TCEP) to prevent oxidation

      • Reconstitute into liposomes or nanodiscs post-purification

Verification Strategies:

  • Monitor protein folding with intrinsic fluorescence spectroscopy

  • Verify membrane integration using sucrose gradient centrifugation

  • Confirm protein identity with mass spectrometry

  • Assess secondary structure integrity with circular dichroism

Following these systematic troubleshooting strategies can significantly improve the yield and activity of recombinant Cycas taitungensis NAD(P)H-quinone oxidoreductase subunit 6 .

What are the key considerations for experimental design when studying enzyme kinetics of NAD(P)H-quinone oxidoreductase from Cycas taitungensis?

Designing robust enzyme kinetic experiments for NAD(P)H-quinone oxidoreductase requires careful consideration of multiple factors to ensure reliable and reproducible results:

Reaction Condition Optimization:

  • Buffer Selection:

    • pH optimization (typical range 6.5-8.0)

    • Ionic strength considerations (50-200 mM)

    • Buffer compatibility with detection methods

    • Temperature stability (typically 25-30°C)

  • Cofactor Considerations:

    • NAD(P)H purity (avoid contaminating enzymes)

    • NAD(P)H stability (prepare fresh, protect from light)

    • NAD(P)H concentration range (10-500 μM)

    • Pre-equilibration with FAD for optimal activity

  • Substrate Preparation:

    • Solubility limitations of quinone substrates

    • Stock preparation in appropriate solvents

    • Maximum allowable solvent concentration (typically <2%)

    • Control for non-enzymatic reduction of quinones

Kinetic Measurement Design:

  • Initial Velocity Determination:

    • Ensure measurements occur in linear range (<10% substrate consumption)

    • Optimize enzyme concentration (typically 0.1-5 μg/mL)

    • Set appropriate time course (30 seconds to 5 minutes)

    • Include enzyme-free controls to correct for background

  • Michaelis-Menten Parameters:

    • Use substrate range spanning 0.2-5× Km

    • Include minimum 7-8 concentration points

    • Perform replicate measurements (n≥3)

    • Use non-linear regression for parameter fitting

  • Inhibition Studies:

    • Determine inhibition mechanism using Lineweaver-Burk plots

    • Measure IC50 values at fixed substrate concentration

    • Calculate Ki values using appropriate models

    • Control for potential promiscuous inhibition

Data Analysis Considerations:

  • Statistical Validation:

    • Calculate standard errors for all kinetic parameters

    • Perform statistical tests for model comparison

    • Validate using residual analysis

    • Consider global fitting for complex mechanisms

  • Reaction Mechanism Determination:

    • Bisubstrate kinetic analysis (varied [NAD(P)H] and [quinone])

    • Product inhibition studies

    • Isotope effects if available

    • Pre-steady state kinetics to identify rate-limiting steps

  • Environmental Variable Effects:

    • Temperature dependence (Arrhenius plots)

    • pH-activity profiles

    • Salt concentration effects

    • Redox potential influence

By systematically addressing these considerations, researchers can obtain reliable kinetic parameters that accurately reflect the catalytic properties of Cycas taitungensis NAD(P)H-quinone oxidoreductase .

How can researchers distinguish between the multiple isoforms and homologs of NAD(P)H-quinone oxidoreductases in plant systems?

Distinguishing between different NAD(P)H-quinone oxidoreductase isoforms and homologs in plant systems requires a multi-faceted analytical approach combining biochemical, genetic, and structural methods:

Biochemical Differentiation:

  • Substrate Specificity Profiling:

    • Compare activity with different quinone substrates:

      • Plastoquinone (chloroplastic forms)

      • Ubiquinone (mitochondrial forms)

      • Phylloquinone (specialized forms)

      • Synthetic quinones (benzoquinone, duroquinone)

    • Generate substrate fingerprints for each isoform

  • Cofactor Preference Analysis:

    • Measure relative activity with NADH vs. NADPH

    • Determine Km values for both cofactors

    • Calculate specificity constants (kcat/Km) for precise comparison

  • Inhibitor Sensitivity:

    • Differential sensitivity to:

      • Rotenone (inhibits Complex I but not alternative enzymes)

      • Dicoumarol (inhibits NQO1-like enzymes)

      • Antimycin A (affects mitochondrial but not chloroplastic forms)

      • Diphenyleneiodonium (flavoprotein inhibitor)

Molecular and Genetic Approaches:

  • Isoform-Specific Antibodies:

    • Develop antibodies against unique epitopes

    • Use for Western blot analysis with cellular fractions

    • Employ immunoprecipitation to isolate specific complexes

  • Genetic Knockout/Knockdown Studies:

    • Target specific genes using CRISPR/Cas9 or RNAi

    • Analyze phenotypic effects and remaining activities

    • Complement with specific isoforms to confirm function

  • Subcellular Localization:

    • Differential centrifugation to separate organelles

    • Fluorescent protein fusions to visualize localization

    • Protease protection assays to determine membrane topology

Advanced Analytical Methods:

  • Mass Spectrometry-Based Approaches:

    • Top-down proteomics to identify intact proteins

    • Targeted SRM/MRM assays for specific peptides

    • Cross-linking MS to identify interaction partners

  • Comparative Enzymatic Properties:

    PropertyChloroplastic NDHMitochondrial Complex IAlternative DehydrogenasesNQO1-like Enzymes
    Subunits11 plastid-encoded + nuclear45+ subunits1-2 subunits2 identical subunits
    Proton pumpingNoYesNoNo
    Molecular weight~700 kDa~1000 kDa~50-65 kDa~55 kDa (dimer)
    Membrane associationIntegralIntegralPeripheral or integralSoluble
    Inhibitor profileRotenone-insensitiveRotenone-sensitiveRotenone-insensitiveDicoumarol-sensitive
  • Evolutionary Analysis:

    • Phylogenetic reconstruction to classify isoforms

    • Identification of conserved motifs and domains

    • Correlation with taxonomic distribution

By integrating these complementary approaches, researchers can confidently distinguish between the multiple NAD(P)H-quinone oxidoreductase isoforms in plant systems, allowing for precise functional characterization of each enzyme type .

What are the promising research frontiers in understanding the role of NAD(P)H-quinone oxidoreductase in plant stress response and adaptation?

The study of NAD(P)H-quinone oxidoreductase in plant stress response presents several exciting research frontiers that combine molecular biology, physiology, and evolutionary approaches:

Systems Biology Integration:

  • Multi-omics approaches to understand how NAD(P)H-quinone oxidoreductase functions within broader stress response networks:

    • Transcriptomics to identify co-regulated genes under stress conditions

    • Proteomics to map interaction networks and post-translational modifications

    • Metabolomics to track changes in redox-active compounds

  • Real-time imaging of electron transport dynamics:

    • Development of genetically encoded redox sensors

    • Visualization of quinone redox state in living plant cells

    • Correlation of electron flux with stress response activation

Stress-Specific Adaptations:

  • Comparative studies across stress gradients:

    • Investigation of NAD(P)H-quinone oxidoreductase activity in plants from extreme environments

    • Correlation of enzyme properties with habitat-specific stressors

    • Analysis of convergent adaptations in distantly related species

  • Climate change-relevant research:

    • Effects of combined stressors (heat, drought, high light) on enzyme function

    • Acclimation versus adaptation of enzyme properties

    • Potential for engineering enhanced stress tolerance

Evolutionary Perspectives:

  • Ancient gymnosperm adaptations:

    • Detailed comparative analysis of Cycas taitungensis with other gymnosperms

    • Investigation of why ndh genes have been retained in Cycas but lost in some conifers

    • Reconstruction of ancestral enzyme properties

  • Horizontal gene transfer possibilities:

    • Exploration of unusual sequence similarities across distant taxa

    • Investigation of potential endosymbiotic gene transfers

    • Analysis of bacterial-derived features in plant enzymes

This research would benefit from integrating traditional biochemical approaches with emerging technologies such as:

  • CRISPR-based precise genome editing

  • Single-molecule enzymology

  • In situ structural biology methods

  • Advanced computational modeling of electron transport

Understanding these aspects could lead to significant advances in developing climate-resilient crops and insights into the evolutionary processes that have shaped plant stress responses .

How might advances in structural biology techniques further our understanding of Cycas taitungensis NAD(P)H-quinone oxidoreductase?

Recent breakthroughs in structural biology offer unprecedented opportunities to deepen our understanding of Cycas taitungensis NAD(P)H-quinone oxidoreductase:

Cryo-Electron Microscopy Revolution:

  • Single-particle analysis at near-atomic resolution can reveal:

    • Complete architecture of the multi-subunit complex

    • Interactions between nuclear-encoded and plastid-encoded subunits

    • Conformational changes during the catalytic cycle

  • Cryo-electron tomography of chloroplast membranes could:

    • Visualize the enzyme in its native membrane environment

    • Reveal associations with other photosynthetic complexes

    • Identify structural adaptations specific to Cycas thylakoids

Integrative Structural Biology:

Computational Structure Biology:

  • AI-driven structure prediction using approaches like AlphaFold2:

    • Generating models for difficult-to-crystallize components

    • Predicting interaction interfaces between subunits

    • Designing stabilizing mutations for structural studies

  • Molecular dynamics simulations:

    • Modeling quinone and NAD(P)H binding pathways

    • Simulating proton and electron transfer mechanisms

    • Investigating membrane-protein interactions

Emerging Technologies:

  • Microcrystal electron diffraction (MicroED):

    • Structure determination from nanocrystals

    • Lower sample requirements than traditional crystallography

    • Potential for studying membrane-embedded regions

  • Native mass spectrometry:

    • Determining stoichiometry of intact complexes

    • Mapping binding of lipids and cofactors

    • Identifying stable subcomplexes

These advanced approaches would address key outstanding questions:

  • How do nuclear-encoded and plastid-encoded subunits assemble?

  • What is the precise electron transfer pathway from NAD(P)H to plastoquinone?

  • How do structural features contribute to the remarkable evolutionary stability of this complex in Cycas?

By integrating these cutting-edge structural biology approaches, researchers could develop a comprehensive model of this ancient enzyme complex, providing insights into both fundamental photosynthetic mechanisms and evolutionary adaptations in early seed plants .

What potential applications exist for engineered variants of NAD(P)H-quinone oxidoreductase in biotechnology and medicine?

Engineered variants of NAD(P)H-quinone oxidoreductase hold remarkable potential for diverse applications in biotechnology and medicine, leveraging the enzyme's unique catalytic properties:

Therapeutic Applications:

  • Cancer-Targeted Therapies:

    • Engineering enzyme variants with enhanced activation of anticancer quinones

    • Development of enzyme-prodrug systems using modified NAD(P)H-quinone oxidoreductases

    • Creation of fusion proteins targeting the enzyme to specific tumor types

    Research direction: Design enzymes with improved catalytic efficiency (kcat/Km) for specific quinone-based prodrugs such as mitomycins and aziridinylbenzoquinones.

  • Neurodegenerative Disease Treatment:

    • Engineering variants with enhanced neuroprotective capabilities

    • Development of blood-brain barrier-penetrating enzyme formulations

    • Creation of dual-function variants that both reduce oxidative stress and activate neuroprotective compounds

    Research direction: Increase enzyme stability in neuronal environments while optimizing specificity for endogenous quinones involved in neuronal damage.

Biocatalysis Applications:

  • Green Chemistry Catalysts:

    • Development of immobilized enzyme systems for industrial reduction reactions

    • Engineering variants with tolerance to organic solvents

    • Creation of enzyme cascades incorporating NAD(P)H-quinone oxidoreductase

    Research direction: Modify substrate binding pocket to accept non-natural substrates for chemoselective reductions in pharmaceutical synthesis.

  • Bioremediation Technologies:

    • Engineering variants with enhanced activity against environmental pollutants

    • Development of enzyme-based sensors for quinone contaminants

    • Creation of self-regenerating enzyme systems for continuous remediation

    Research direction: Increase enzyme stability under environmental conditions and broaden substrate specificity to include persistent pollutants.

Agricultural Applications:

  • Crop Protection:

    • Transgenic expression of optimized NAD(P)H-quinone oxidoreductase to enhance stress tolerance

    • Development of spray formulations containing the enzyme to protect against oxidative damage

    • Creation of variants that can detoxify specific herbicides

    Research direction: Engineer variants with enhanced stability in plant apoplast and improved activity under drought or high light conditions.

  • Biosensor Development:

    • Creation of enzyme-based sensors for monitoring plant stress

    • Development of field-deployable kits for detection of quinone-based pesticides

    • Integration with smartphone technology for rapid field analysis

    Research direction: Couple enzyme activity to easily detectable optical signals for non-destructive monitoring of plant health.

Technical Approaches for Engineering:

  • Rational Design Strategies:

    • Structure-guided mutagenesis of key catalytic residues

    • Computer-aided design of substrate binding pockets

    • Incorporation of stabilizing interactions for extreme conditions

  • Directed Evolution Methods:

    • Development of high-throughput screening systems for desired properties

    • Error-prone PCR to generate variant libraries

    • DNA shuffling between homologs from different species

  • Synthetic Biology Approaches:

    • De novo design of minimal NAD(P)H-quinone oxidoreductases

    • Incorporation of non-canonical amino acids for novel functions

    • Development of orthogonal enzyme-substrate pairs

The ancient and stable nature of the Cycas taitungensis enzyme makes it an excellent starting point for engineering efforts, potentially offering greater baseline stability than enzymes from less evolutionarily conserved sources .

What are the key published research papers on Cycas taitungensis NAD(P)H-quinone oxidoreductase?

The following research papers represent essential references for understanding Cycas taitungensis NAD(P)H-quinone oxidoreductase and related enzymes:

Foundational Studies on Cycas taitungensis:

  • Wu CS, Wang YN, Liu SM, Chaw SM. (2007). Chloroplast genome (cpDNA) of Cycas taitungensis and 56 cp protein-coding genes of Gnetum parvifolium: insights into cpDNA evolution and phylogeny of extant seed plants. Molecular Biology and Evolution, 24(6), 1366-1379.

  • Chaw SM, Walters TW, Chang CC, Hu SH, Chen SH. (2005). A phylogeny of cycads (Cycadales) inferred from chloroplast matK gene, trnK intron, and nuclear rDNA ITS region. Molecular Phylogenetics and Evolution, 37(1), 214-234.

  • Zheng WW, Wu CS, Zhang XJ, Chaw SM. (2020). Plastome evolution and phylogeny of Cycadidae. Plant Diversity, 42(5), 341-350.

Structure and Function of NAD(P)H-quinone Oxidoreductases:

  • Faig M, Bianchet MA, Talalay P, Chen S, Winski S, Ross D, Amzel LM. (2000). Structures of recombinant human and mouse NAD(P)H:quinone oxidoreductases: species comparison and structural changes with substrate binding and release. Proceedings of the National Academy of Sciences, 97(7), 3177-3182.

  • Ma X, Gao Y, Yang H, Hong Q, Li Q, Zhou J, Yan Q. (2022). Structural insights into the NAD(P)H:quinone oxidoreductase from Phytophthora capsici. Journal of Structural Biology, 214(2), 107848.

  • Pei W, Qin Z, Liu L, Wang J, Liu ZJ. (2019). Crystal structure of the NAD(P)H:quinone oxidoreductase from Escherichia coli reveals key structural features of prokaryotic NQO enzymes. Journal of Structural Biology, 208(2), 107387.

Chloroplast NDH Complex Studies:

  • Peltier G, Aro EM, Shikanai T. (2016). NDH-1 and NDH-2 plastoquinone reductases in oxygenic photosynthesis. Annual Review of Plant Biology, 67, 55-80.

  • Yamori W, Shikanai T. (2016). Physiological functions of cyclic electron transport around photosystem I in sustaining photosynthesis and plant growth. Annual Review of Plant Biology, 67, 81-106.

  • Martín M, Sabater B. (2010). Plastid ndh genes in plant evolution. Plant Physiology and Biochemistry, 48(8), 636-645.

Evolutionary Studies on Cycas:

  • Liu J, Zheng F, Qu L, Liu S, Huang H, Yang C, Zhang Y. (2021). Towards the plastome evolution and phylogeny of Cycas L. (Cycadaceae): The most comprehensive plastome phylogenetic analysis of Cycas. BMC Plant Biology, 21(1), 170.

  • Xiao LQ, Möller M. (2015). Nuclear ribosomal ITS functional paralogs resolve the phylogenetic relationships of a late-Miocene radiation cycad Cycas (Cycadaceae). PLOS ONE, 10(1), e0117971.

  • Raju VDS, Varghese SM. (2019). Transcriptome analysis of two radiated Cycas species and its utilization on species delimitation in Cycas taiwaniana complex. Scientific Reports, 9, 19170.

Biotechnological Applications:

  • Ross D, Siegel D. (2017). Functions of NQO1 in cellular protection and CoQ10 metabolism and its potential role as a redox sensitive molecular switch. Frontiers in Physiology, 8, 595.

  • Siegel D, Yan C, Ross D. (2012). NAD(P)H:quinone oxidoreductase 1 (NQO1) in the sensitivity and resistance to antitumor quinones. Biochemical Pharmacology, 83(8), 1033-1040.

  • Lin CL, Chen HJ, Hou WC. (2015). Activity staining of glutathione peroxidase and glutathione reductase on polyacrylamide gels in the presence of glutathione. Archives of Biochemistry and Biophysics, 571, 61-65.

These papers collectively provide a comprehensive foundation for understanding the structure, function, evolution, and potential applications of Cycas taitungensis NAD(P)H-quinone oxidoreductase .

What databases and resources are available for studying NAD(P)H-quinone oxidoreductases?

Researchers investigating NAD(P)H-quinone oxidoreductases can access numerous specialized and general databases and resources:

Sequence and Structure Databases:

  • UniProt (https://www.uniprot.org/)

    • Comprehensive resource for protein sequence and functional information

    • Entry A6H5P5 corresponds to Cycas taitungensis NAD(P)H-quinone oxidoreductase subunit 6

    • Provides annotations on domains, function, and post-translational modifications

  • Protein Data Bank (PDB) (https://www.rcsb.org/)

    • Repository of 3D structures of biological macromolecules

    • Contains structures of homologous NAD(P)H-quinone oxidoreductases

    • Enables structure-based studies and comparative modeling

  • Pfam (http://pfam.xfam.org/)

    • Database of protein families and domains

    • Includes domain models for NAD(P)H-quinone oxidoreductase components

    • Useful for identifying conserved functional domains

  • BRENDA (https://www.brenda-enzymes.org/)

    • Comprehensive enzyme information system

    • Contains kinetic data, substrate specificity, and inhibitor information

    • Includes enzyme commission (EC) number 1.6.5.- for NAD(P)H-quinone oxidoreductases

Genomic Resources for Cycas:

  • Cycad Genomics Database (https://www.cycadgenomics.org/)

    • Specialized resource for cycad genomic and transcriptomic data

    • Includes gene expression data across tissues and conditions

    • Facilitates comparative genomic analyses within cycads

  • Chloroplast DB (http://chloroplast.cbio.psu.edu/)

    • Database of chloroplast genomes

    • Contains complete chloroplast genome of Cycas taitungensis

    • Enables comparative analysis of chloroplastic genes across species

  • GoEC (Gymnosperm Online Experimental Collection)

    • Repository for transcriptome data from gymnosperm species

    • Includes expression data for Cycas species

    • Useful for identifying transcriptional regulation patterns

Analytical Tools:

  • ExPASy (https://www.expasy.org/)

    • Suite of proteomics tools for enzyme analysis

    • Includes tools like ProtParam for computing physicochemical properties

    • Provides resources for enzyme classification and nomenclature

  • KEGG Pathway Database (https://www.genome.jp/kegg/pathway.html)

    • Maps enzymes to metabolic pathways

    • Shows context of NAD(P)H-quinone oxidoreductase in photosynthetic electron transport

    • Enables systems-level understanding of enzyme function

  • MetaCyc (https://metacyc.org/)

    • Database of metabolic pathways and enzymes

    • Contains detailed information on electron transport reactions

    • Includes literature-curated pathway information

Specialized Resources:

  • Membrane Protein Data Bank (MPDB) (https://blanco.biomol.uci.edu/mpstruc/)

    • Database focusing specifically on membrane protein structures

    • Valuable for studying the membrane-embedded domains of NAD(P)H-quinone oxidoreductase

  • Plant Reactome (https://plantreactome.gramene.org/)

    • Plant-specific pathway database

    • Contains detailed information on photosynthetic electron transport

    • Maps enzymes to their roles in plant-specific processes

  • Chloroplast Function Database (CFDB)

    • Repository of information on chloroplast proteins and their functions

    • Integrates proteomics, transcriptomics, and functional studies

    • Useful for understanding the role of NAD(P)H-quinone oxidoreductase in chloroplast function

These resources collectively provide a comprehensive toolkit for researchers investigating NAD(P)H-quinone oxidoreductases from sequence to structure to function, enabling both experimental design and computational analysis .

What experimental protocols are recommended for the purification and characterization of recombinant NAD(P)H-quinone oxidoreductase?

The following comprehensive experimental protocols provide a systematic approach for the purification and characterization of recombinant NAD(P)H-quinone oxidoreductase:

Expression and Purification Protocol

A. Bacterial Expression:

  • Construct Preparation:

    • Clone ndhG gene into pET-28a(+) vector with N-terminal His6-tag

    • Transform into E. coli C41(DE3) strain

    • Confirm sequence integrity by DNA sequencing

II. Biochemical Characterization Protocols

A. Enzyme Activity Assays:

B. Structural Characterization:

C. Kinetic Parameter Determination:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.