Recombinant Cycas taitungensis Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Cycas taitungensis Photosystem II CP47 chlorophyll apoprotein (psbB) is a genetically engineered variant of the CP47 protein, a critical subunit of Photosystem II (PSII) in chloroplasts. This protein binds chlorophyll a and serves as a core antenna complex, facilitating light energy absorption and transfer to the PSII reaction center . In Cycas taitungensis (a cycad species), psbB encodes CP47, which is essential for PSII assembly and function .

Production and Purification

Recombinant CP47 is synthesized via heterologous expression in E. coli, followed by affinity chromatography (e.g., His-tag purification) . Key steps include:

  1. Cloning: psbB gene insertion into expression vectors.

  2. Expression: Induction with IPTG or similar agents.

  3. Purification: Nickel-affinity chromatography for His-tagged proteins .

  4. Quality Control: SDS-PAGE and Western blot validation .

Role in Photosystem II

  • CP47 stabilizes the PSII reaction center and interacts with D1/D2 proteins .

  • Mutations in CP47 disrupt PSII assembly, leading to impaired oxygen evolution .

Table 2: Comparative Analysis of CP47 Across Species

SpeciesChlorophyll-Binding MotifsUnique FeaturesReference
Cycas taitungensisConserved Tyr residuesHigh stability in Tris buffer
Lactuca sativa (lettuce)Similar to CycasAltered Chl a/Chl b ratio
Anthoceros formosaeDivergent C-terminalEnhanced thermostability

Applications in Research

  • Photosynthesis Studies: Used to investigate PSII assembly and electron transport mechanisms .

  • Phylogenetics: psbB sequences aid in resolving evolutionary relationships in cycads and gymnosperms .

  • Biotechnological Tools: Recombinant CP47 serves as an antigen in ELISA for antibody development .

Research Limitations and Future Directions

  • Challenges: Low solubility of recombinant CP47 in non-denaturing buffers .

  • Opportunities:

    • Structural studies using cryo-EM to resolve CP47-PSII interactions .

    • Engineering CP47 for improved photosynthetic efficiency in crops .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request whenever possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All protein shipments are made with standard blue ice packs unless otherwise requested. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize its inclusion whenever possible.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Cycas taitungensis (Prince sago) (Cycas taiwaniana)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLSVHIMHTALVSGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGINNSWGGWSITGETVTNPGLWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL DIFCDERTGKPSLDLPKIFGIHLFLSGVACFGSGAFHVTGLYGPGIWVSDPYGLTGKIQP VNPAWGAEGFDPFVPGGIASHHIAAGILGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFIVAGTMWYGSATAPVELFGPTRYQWDQGYFQQEIDRRVRAGLSENLSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGAMDNGDGIAVGWLGHPIFRDKEGHELFVRRMP TFFETFPVVLVDEEGIVKADVPFRRAESKYSVEQVGVTVEFYGGELDGVSFGDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHATFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQXLGDPTTKRQIV
Uniprot No.

Target Background

Function
Cycas taitungensis Photosystem II CP47 chlorophyll apoprotein (psbB) is a key component of the Photosystem II (PSII) core complex. It binds chlorophyll and plays a vital role in catalyzing the primary light-induced photochemical reactions within PSII. PSII functions as a light-driven water:plastoquinone oxidoreductase, utilizing light energy to extract electrons from H2O, generating O2 and a proton gradient that subsequently drives ATP formation.
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the evolutionary significance of studying CP47 chlorophyll apoprotein from Cycas taitungensis?

Cycas taitungensis represents a unique evolutionary position as a relict species endemic to Taiwan, specifically to the mountainous southern parts of Taitung province. This cycad species occurs in a limited geographic range of approximately 65 km² and has adapted to specific environmental conditions including periodic fires and rocky, steep slopes . Studying the CP47 chlorophyll apoprotein (psbB) from this ancient gymnosperm lineage provides valuable insights into the evolutionary conservation of photosynthetic machinery across plant taxa. The protein's structure and function in this primitive seed plant can reveal adaptations that have persisted through evolutionary time, particularly in relation to light-harvesting efficiency under the specific environmental conditions of its limited habitat. Comparative analysis with CP47 from other photosynthetic organisms can illuminate evolutionary patterns in photosystem structure and function across divergent plant lineages.

How does the structure of CP47 from Cycas taitungensis compare to that of model organisms?

The CP47 complex from Cycas taitungensis, like other CP47 proteins, functions as an integral antenna of Photosystem II (PSII) responsible for efficient excitation energy transfer to the PSII reaction center . Structurally, CP47 from various organisms contains 16 chlorophyll molecules whose spatial arrangement and electronic properties define the mechanisms of energy transfer . While the search results don't provide specific structural data on Cycas taitungensis CP47, comparative analysis would likely reveal both conserved features essential for function and species-specific adaptations.

Research methodologies for such comparisons typically involve:

  • X-ray crystallography or cryo-electron microscopy for high-resolution structural determination

  • Sequence alignment analysis to identify conserved domains across species

  • Spectroscopic techniques to characterize chlorophyll arrangements and interactions

  • Computational modeling to predict three-dimensional structures and compare them with those of model organisms such as cyanobacteria or Arabidopsis thaliana

What are the challenges in expressing recombinant Cycas taitungensis CP47 protein in heterologous systems?

Expression of recombinant CP47 from any species presents significant challenges due to its membrane-embedded nature, complex folding requirements, and the need for proper chlorophyll incorporation. For Cycas taitungensis CP47 specifically, additional challenges may include:

  • Codon optimization requirements for the gymnosperm gene sequence when expressed in bacterial or yeast systems

  • Post-translational modifications specific to plant chloroplasts that may be absent in prokaryotic expression systems

  • Proper assembly with chlorophyll molecules, which requires specialized biosynthetic pathways

  • Maintaining protein stability outside its native membrane environment

  • Co-expression requirements with other PSII components for proper folding

Researchers typically address these challenges through strategies such as:

  • Using specialized expression vectors with chloroplast-targeting sequences

  • Co-expression with chlorophyll biosynthesis genes

  • Inclusion of molecular chaperones to aid proper folding

  • Creating fusion proteins to enhance solubility

  • Testing multiple expression systems (E. coli, yeast, insect cells, plant-based) to identify optimal conditions

What are the most effective protocols for isolating intact CP47 complex from Cycas taitungensis?

Isolation of intact CP47 complex requires careful consideration of sample handling to prevent destabilization. Based on protocols for CP47 isolation from other species, the following methodological approach would be recommended for Cycas taitungensis:

  • Tissue selection: Young, photosynthetically active fronds should be harvested, as Cycas taitungensis produces large fronds 130-180 cm long that provide substantial starting material .

  • Thylakoid membrane isolation:

    • Homogenize tissue in buffer containing sorbitol, HEPES, EDTA at pH 7.5

    • Filter through multiple layers of cheesecloth

    • Centrifuge at low speed to remove debris

    • Pellet thylakoids by high-speed centrifugation (40,000 × g)

  • Membrane solubilization:

    • Resuspend thylakoids in buffer with n-dodecyl-β-D-maltoside (β-DM) at 0.5-1.0%

    • Maintain proper detergent:chlorophyll ratio (typically 20:1)

    • Incubate with gentle agitation at 4°C for 30 minutes

  • Purification:

    • Initial separation by ultracentrifugation

    • Column chromatography (typically anion exchange followed by size exclusion)

    • Sucrose gradient ultracentrifugation for final purification

Critical considerations include maintaining the presence of the PsbH subunit, which forms a hydrogen bond with Chl29 of CP47 through Thr5 . Research indicates that weakened or broken hydrogen bonds between CP47 chlorophylls and amino acid residues can result in variable blueshifted emission spectra . Therefore, buffer conditions maintaining these interactions are essential for isolating truly intact complexes.

How can researchers validate the functional integrity of recombinant CP47 protein?

Validation of functional integrity for recombinant CP47 protein should employ multiple complementary approaches:

  • Spectroscopic analysis:

    • Absorption spectroscopy (comparing with native CP47 spectra)

    • Low-temperature (5K and 77K) emission spectroscopy to verify the characteristic ~695 nm emission peak indicative of intact CP47 complexes

    • Circular dichroism (CD) to verify proper protein folding and pigment-protein interactions

  • Excitation energy transfer assessment:

    • Time-resolved fluorescence spectroscopy to measure energy transfer kinetics

    • Transient absorption spectroscopy to track excitation dynamics

    • Hole-burning (HB) spectroscopy at 5K to assess non-photochemical hole-burning characteristics

  • Chlorophyll content analysis:

    • HPLC quantification of bound chlorophyll molecules

    • Verification of the expected 16 chlorophyll molecules per CP47 complex

  • Structural integrity assessment:

    • Native gel electrophoresis to confirm complex size and homogeneity

    • Size exclusion chromatography to verify monodispersity

    • Mass spectrometry to confirm protein mass and post-translational modifications

A critical validation criterion is comparing spectroscopic properties with those of intact CP47 complexes. As noted in research, many published CP47 spectra represent mixtures of intact and destabilized complexes, whereas truly intact CP47 shows distinctive spectral features at 5K and 77K .

What expression systems yield the highest functional recombinant CP47 protein from Cycas taitungensis?

Selection of an appropriate expression system for recombinant CP47 from Cycas taitungensis should consider the following factors and methodological approaches:

Expression SystemAdvantagesLimitationsOptimization Strategies
E. coliHigh yield, low cost, rapid growthLacks chloroplast machinery, challenging membrane protein foldingFusion with solubility tags, inclusion of chlorophyll derivatives, expression at low temperature (16-18°C)
Yeast (P. pastoris)Eukaryotic folding machinery, scalableDifferences in membrane compositionOptimization of induction conditions, supplementation with chlorophyll precursors
Insect cellsComplex protein production capability, post-translational modificationsHigher cost, slower productionCodon optimization, baculovirus optimization, supplementation with chlorophyll
Plant expression systemsNative-like environment, proper cofactor assemblyLower yields, longer production timeChloroplast transformation, transient expression systems, use of strong promoters
Cyanobacterial systemsNatural photosynthetic machinerySpecies-specific adaptationsGene replacement strategies, inducible promoters

For CP47 specifically, cyanobacterial or plant-based expression systems are most likely to yield functional protein due to their natural photosynthetic machinery. The methodological approach should include co-expression with chlorophyll biosynthesis genes and other PSII components required for proper assembly.

How do site-directed mutations in recombinant CP47 from Cycas taitungensis affect excitation energy transfer?

Site-directed mutagenesis of CP47 provides valuable insights into structure-function relationships, particularly regarding excitation energy transfer. Based on quantum mechanics/molecular mechanics (QM/MM) approaches and time-dependent density functional theory studies of CP47 , several key considerations emerge for mutation studies:

These experiments would contribute to understanding the specific adaptations of Cycas taitungensis CP47 that may have evolved in response to its unique ecological niche.

What are the differences in chlorophyll site energies between CP47 from Cycas taitungensis and other photosynthetic organisms?

Determining chlorophyll site energies requires advanced spectroscopic and computational approaches. Research on CP47 from cyanobacterial sources has revealed important insights applicable to studies of Cycas taitungensis CP47:

  • Methodological approach for site energy determination:

    • Quantum mechanics/molecular mechanics (QM/MM) with time-dependent density functional theory

    • Utilization of range-separated functionals to compute excitation energies

    • Analysis within complete membrane-embedded models to maintain native-like environment

  • Key findings from CP47 research:
    Recent high-level quantum chemical studies have identified B3, followed by B1, as the most red-shifted chlorophylls in cyanobacterial CP47, differing from previous literature hypotheses . This highlights the importance of employing advanced computational methods when studying Cycas taitungensis CP47.

  • Comparison framework:
    When comparing CP47 from different species, researchers should:

    • Employ consistent computational methods across species

    • Consider the specific protein environment affecting electrostatics

    • Analyze the impact of evolutionary adaptations on pigment arrangements

    • Account for species-specific differences in membrane composition

  • Analysis of environmental effects:
    For Cycas taitungensis specifically, researchers should consider adaptations to its unique habitat conditions:

    • Rocky, steep slopes with periodic fires

    • Mixed, sparse forests in exposed sites

    • High light stress conditions

    • Drought tolerance requirements

These environmental factors may have driven evolutionary adaptations in the protein-pigment interactions within CP47, potentially resulting in species-specific site energy distributions optimized for its ecological niche.

How does the presence or absence of the PsbH subunit affect CP47 stability and function in recombinant systems?

The PsbH subunit plays a critical role in CP47 stability and function, as indicated by research on CP47 complexes:

  • Structural importance:
    The PsbH protein forms a hydrogen bond with Chl29 of CP47 through its Thr5 residue . When this hydrogen bond is weakened or broken, a blueshift of the Chl29 site energy occurs, resulting in variable blueshifted emission spectra .

  • Methodological approaches to study PsbH effects:

    • Co-expression studies with and without PsbH

    • Site-directed mutagenesis of the Thr5 residue in PsbH

    • Spectroscopic comparison of CP47 with intact versus disrupted PsbH interaction

    • Stability assays under varying temperature and detergent conditions

  • Experimental design considerations:
    Researchers working with recombinant Cycas taitungensis CP47 should:

    • Design constructs allowing optional co-expression with PsbH

    • Develop methods to assess hydrogen bonding between PsbH and CP47

    • Employ low-temperature spectroscopy (5K and 77K) to detect spectral shifts indicative of PsbH interaction

    • Utilize molecular dynamics simulations to predict stability changes

  • Impact on experimental outcomes:
    The presence or absence of PsbH has been linked to:

    • Changes in the 695 nm emission band intensity

    • Altered structural stability of isolated CP47 complexes

    • Different spectroscopic properties at low temperatures

    • Variable success in crystallization attempts

For recombinant expression systems, this suggests that co-expression with PsbH is likely critical for obtaining functionally and structurally intact CP47 complexes that accurately represent the native protein from Cycas taitungensis.

What strategies can resolve protein aggregation issues during recombinant CP47 purification?

Protein aggregation represents a significant challenge when working with membrane proteins like CP47. The following methodological approaches can help resolve these issues:

  • Buffer optimization:

    • Screen detergent types and concentrations (β-DM, α-DDM, LMNG)

    • Test various ionic strengths (typically 100-300 mM NaCl)

    • Optimize pH range (usually 6.5-8.0)

    • Include stabilizing agents (glycerol 5-15%, sucrose 5-10%)

    • Add specific lipids that maintain native-like environment

  • Temperature management:

    • Maintain all purification steps at 4°C

    • Consider flash-freezing aliquots in liquid nitrogen for storage

    • Avoid freeze-thaw cycles

    • Test thermal stability at various temperatures to determine optimal handling conditions

  • Advanced purification strategies:

    • Size exclusion chromatography as final purification step

    • Implementation of fluorescence-detection size exclusion chromatography (FSEC)

    • On-column detergent exchange during purification

    • Limited proteolysis to remove flexible regions prone to aggregation

  • Additive screening:

    • Test various chlorophyll concentrations

    • Include specific lipids from thylakoid membranes

    • Try physiologically relevant ions (Mg²⁺, Ca²⁺)

    • Consider amphipols or nanodiscs for detergent-free environments

Successful strategies should be validated through methods such as dynamic light scattering to confirm monodispersity, negative-stain electron microscopy to visualize protein particles, and functional assays to ensure the non-aggregated protein maintains native activity.

How can researchers optimize chlorophyll incorporation into recombinant CP47 protein?

Proper chlorophyll incorporation is essential for functional CP47. The following methodological approaches can optimize this process:

  • Co-expression strategies:

    • Express chlorophyll biosynthesis genes alongside CP47

    • Supply chlorophyll precursors in growth media

    • Use expression systems with endogenous chlorophyll synthesis capability

    • Consider two-plasmid systems: one for CP47 and one for chlorophyll synthesis

  • In vitro reconstitution methods:

    • Extract chlorophyll from plant material (preferably Cycas taitungensis itself)

    • Develop optimized reconstitution protocols with controlled chlorophyll:protein ratios

    • Perform reconstitution under dim green light to prevent photooxidation

    • Gradually remove detergent during reconstitution to promote proper binding

  • Verification methods:

    • Absorption spectroscopy to confirm chlorophyll binding (characteristic peaks)

    • Size exclusion chromatography with dual detection (280 nm for protein, 675 nm for chlorophyll)

    • Pigment extraction and HPLC analysis to quantify bound chlorophyll

    • Fluorescence emission spectroscopy to confirm functional binding

  • Troubleshooting approaches:

    • If chlorophyll binding is poor, adjust detergent concentration and type

    • Test different pH conditions (typically pH 6.5-8.0)

    • Include stabilizing agents (glycerol, specific lipids)

    • Try various incubation times for reconstitution (4-48 hours)

Researchers must verify that all 16 chlorophyll molecules are correctly incorporated into the CP47 complex, as incomplete chlorophyll binding would result in non-native spectroscopic properties and altered function.

What analytical techniques best resolve contradictory data about CP47 excitation energy dynamics?

Research on CP47 has produced some contradictory results regarding excitation energy dynamics, particularly in identifying the lowest energy chlorophylls. To resolve such contradictions, researchers should employ complementary analytical approaches:

  • Advanced spectroscopic techniques:

    • Hole-burning (HB) spectroscopy at 5K, which can distinguish intact from destabilized complexes

    • Two-dimensional electronic spectroscopy (2DES) to map energy transfer pathways

    • Transient absorption spectroscopy with ultrafast time resolution

    • Single-molecule spectroscopy to detect heterogeneity within samples

  • Computational approaches:

    • QM/MM simulations using range-separated functionals

    • Non-Markovian reduced density matrix theory with Nelder-Mead simplex algorithm

    • Molecular dynamics simulations to assess structural stability

    • Combined quantum chemistry and exciton dynamics modeling

  • Systematic analysis of experimental variables:

    • Compare identical preparations under different environmental conditions

    • Assess the impact of detergent concentration on spectroscopic properties

    • Evaluate the influence of PsbH presence on experimental outcomes

    • Test temperature dependence of spectroscopic features

  • Data integration framework:
    The following table illustrates how researchers might integrate contradictory data:

    ModelLowest Energy ChlorophyllSupporting EvidenceContradicting EvidenceResolution Approach
    24AChl24 (92% contribution)Perfect fit to ~695 nm emission Different from previously reported modelsCompare preparation integrity, verify using multiple spectroscopic techniques
    26AChl26Good fit to experimental spectra Different site energy calculationsEvaluate impact of specific protein environment
    29AChl29Consistent with some previous models Inconsistent with newest TDDFT calculationsAssess impact of PsbH interaction with Chl29
  • Recommended analytical workflow:

    • Start with absorption and emission spectroscopy to characterize samples

    • Perform time-resolved measurements to determine energy transfer rates

    • Conduct computational modeling with consistent parameters

    • Validate models against multiple experimental datasets

    • Identify specific conditions leading to contradictory results

By integrating these approaches, researchers can better understand the true excitation energy dynamics in CP47 from Cycas taitungensis and resolve contradictions in the existing literature.

How might CP47 from Cycas taitungensis inform the design of artificial photosynthetic systems?

CP47 from Cycas taitungensis represents an evolutionarily distinct photosynthetic system that may offer unique insights for artificial photosynthesis design:

  • Structural adaptations of interest:

    • Arrangement of chlorophyll molecules that optimize energy transfer

    • Protein-pigment interactions that tune site energies

    • Structural features that enhance stability under stress conditions

    • Specific amino acid residues creating the microenvironment for efficient energy transfer

  • Methodological approaches for translation to artificial systems:

    • Identify key structural motifs through comparative analysis with other CP47 proteins

    • Design minimalist peptide scaffolds that recreate critical chlorophyll-binding domains

    • Test hybrid systems incorporating recombinant CP47 components with synthetic materials

    • Develop biomimetic nanostructures based on CP47 architecture

  • Potential applications:

    • Solar energy conversion devices with enhanced light-harvesting efficiency

    • Biomimetic catalysts for water oxidation

    • Sensors based on fluorescence properties of CP47-inspired constructs

    • Light-harvesting components for molecular electronics

  • Research roadmap:

    • Comprehensive structural characterization of Cycas taitungensis CP47

    • Comparative analysis with CP47 from diverse photosynthetic organisms

    • Identification of unique features contributing to function in its native environment

    • Iterative design and testing of simplified artificial systems

    • Integration with other photosynthetic components

Understanding the specific adaptations in CP47 from this ancient gymnosperm lineage could reveal robust design principles that have withstood evolutionary pressures, potentially informing more efficient and stable artificial photosynthetic systems.

What genomic approaches can address limitations in recombinant production of CP47 from rare species like Cycas taitungensis?

Given that Cycas taitungensis is endangered with a limited geographic distribution , sustainable approaches for studying its proteins are essential:

  • DNA synthesis and codon optimization:

    • De novo synthesis of the psbB gene based on published sequences

    • Codon optimization for various expression systems

    • Introduction of affinity tags for purification without altering function

    • Design of constructs with inducible promoters to control expression

  • Comparative genomics approaches:

    • Analyze CP47 sequences across cycad species to identify conserved regions

    • Use phylogenomic analysis to predict functional domains

    • Employ ancestral sequence reconstruction to infer evolutionary adaptations

    • Design chimeric constructs combining domains from different species

  • Transcriptomic analysis:

    • RNA-Seq of Cycas taitungensis under various light conditions

    • Identification of natural isoforms and splice variants

    • Analysis of co-expressed genes that may affect CP47 function

    • Assessment of expression patterns to optimize recombinant production

  • CRISPR-based approaches:

    • Development of model systems with edited photosystem components

    • Replacement of endogenous psbB genes in cyanobacteria with Cycas taitungensis variants

    • Creation of reporter systems to monitor expression and assembly

    • Engineering of minimally modified versions for functional studies

These genomic approaches can help overcome the limitations imposed by the endangered status of Cycas taitungensis, allowing detailed study of its photosynthetic proteins while minimizing impact on wild populations.

How does the CP47 protein from Cycas taitungensis differ in its response to environmental stressors compared to other species?

Understanding CP47's response to environmental stressors provides insights into photosynthetic adaptations in Cycas taitungensis:

  • Relevant environmental factors:
    Cycas taitungensis grows in exposed sites on rocky and steep slopes, in well-drained gravel, and experiences periodic fires . These conditions suggest adaptations to:

    • High light stress

    • Temperature fluctuations

    • Periodic drought

    • Recovery after fire damage

  • Methodological approaches for comparative stress response studies:

    • Express recombinant CP47 from Cycas taitungensis and model organisms

    • Subject proteins to controlled stress conditions:

      • Heat treatment (30-50°C for varying durations)

      • High light exposure (1000-2000 μmol photons m⁻² s⁻¹)

      • Oxidative stress (H₂O₂ treatment)

      • Dehydration/rehydration cycles

    • Analyze structural and functional changes using:

      • Spectroscopic measurements before and after stress

      • Thermal stability assays (differential scanning fluorimetry)

      • Protease sensitivity assays to detect conformational changes

      • Molecular dynamics simulations under varying conditions

  • Expected observations and hypotheses:

    • CP47 from Cycas taitungensis may show enhanced thermal stability

    • Altered energy dissipation pathways under high light stress

    • Specific structural features maintaining chlorophyll organization during stress

    • Potentially unique post-translational modifications related to stress response

  • Applications of findings:

    • Identification of stress-resistant protein domains for engineering

    • Development of more resilient photosynthetic systems

    • Understanding evolutionary adaptations in ancient plant lineages

    • Insights into photoprotection mechanisms in specialized environments

This research would contribute to understanding how photosynthetic machinery has adapted to extreme environments through evolutionary time, with potential applications in engineering stress-resistant crops and artificial photosynthetic systems.

What are the key distinguishing features of CP47 from Cycas taitungensis compared to other well-studied photosynthetic systems?

While specific data on Cycas taitungensis CP47 is limited in the provided search results, a synthesis of available information suggests several potential distinguishing features:

  • Evolutionary context:
    As a member of the ancient cycad lineage, Cycas taitungensis CP47 may retain ancestral features that have been modified in more recently evolved plant groups. The relict nature of this species makes its photosynthetic proteins particularly valuable for understanding the evolution of light-harvesting systems.

  • Habitat adaptations:
    The species' adaptation to rocky, steep slopes with periodic fires and drought conditions may be reflected in structural and functional adaptations in its CP47 protein, potentially including:

    • Enhanced stability under environmental stress

    • Specific chlorophyll arrangements optimized for its light environment

    • Unique protein-pigment interactions tuned to its ecological niche

  • Methodological considerations for comparative studies:
    When comparing Cycas taitungensis CP47 to other systems, researchers should:

    • Use consistent experimental approaches across species

    • Consider the impact of isolation methods on protein integrity

    • Employ multiple spectroscopic techniques, particularly at low temperatures

    • Apply advanced computational modeling to interpret subtle differences

  • Integration with broader knowledge:
    Understanding CP47 from Cycas taitungensis contributes to:

    • Comprehensive models of photosystem evolution

    • Insights into structure-function relationships in photosynthetic proteins

    • Development of more robust artificial photosynthetic systems

    • Conservation strategies for endangered photosynthetic organisms

This synthesis highlights the scientific value of studying CP47 from evolutionarily significant and endangered species like Cycas taitungensis, particularly using recombinant approaches that minimize impact on wild populations.

What integrated research approach would most effectively advance understanding of recombinant Cycas taitungensis CP47?

An integrated research approach combining multiple disciplines and methodologies would most effectively advance understanding of this protein:

  • Multidisciplinary framework:

    • Structural biology (crystallography, cryo-EM)

    • Advanced spectroscopy (ultrafast, single-molecule)

    • Biochemistry and protein engineering

    • Computational modeling (QM/MM, molecular dynamics)

    • Evolutionary and comparative genomics

    • Synthetic biology for recombinant expression

  • Methodological integration strategy:

    • Begin with genomic analysis and gene synthesis

    • Optimize expression in multiple systems concurrently

    • Perform parallel structural and functional characterization

    • Develop computational models informed by experimental data

    • Validate models through site-directed mutagenesis

    • Apply findings to design of biomimetic systems

  • Research coordination framework:

    • Establishment of standardized protocols for CP47 isolation and characterization

    • Creation of shared resources (plasmids, purified proteins, analytical tools)

    • Development of common data formats and repositories

    • Regular integration of findings across research groups

  • Impact assessment metrics:

    • Contributions to fundamental understanding of photosynthesis

    • Applications in synthetic biology and artificial photosynthesis

    • Development of new methodologies for membrane protein research

    • Conservation implications for endangered photosynthetic species

This integrated approach would maximize research efficiency while minimizing the environmental impact of studying proteins from endangered species like Cycas taitungensis.

How might insights from CP47 research contribute to conservation strategies for endangered cycads like Cycas taitungensis?

Research on CP47 and other photosynthetic proteins from Cycas taitungensis can significantly contribute to conservation efforts:

  • Physiological insights supporting conservation:

    • Understanding photosynthetic adaptations to specific habitat conditions

    • Identifying optimal light conditions for ex situ cultivation

    • Determining stress tolerance thresholds for reintroduction programs

    • Characterizing photosynthetic efficiency under various environmental conditions

  • Methodological approaches linking molecular research to conservation:

    • Development of non-destructive sampling techniques for protein studies

    • Creation of tissue culture protocols informed by protein expression patterns

    • Establishment of photosynthetic efficiency as a health biomarker for conservation

    • Application of genomic tools to assess population viability

  • Conservation applications:

    • Optimization of growth conditions in botanical gardens and conservation facilities

    • Selection of suitable reintroduction sites based on photosynthetic requirements

    • Development of stress resistance markers for monitoring programs

    • Creation of molecular toolkits for rapid assessment of plant health

  • Integration with existing conservation programs:
    Cycas taitungensis is currently protected in the Taitung Hongyeh Village Cycas Nature Reserve, with approximately 1,700 plants remaining in the wild . Research on its photosynthetic proteins could inform:

    • Habitat management practices within the reserve

    • Ex situ conservation priorities

    • Mitigation strategies for threats like Aulacaspis scale invasion

    • Climate change adaptation planning

By connecting molecular-level research to ecosystem-level conservation strategies, studies of CP47 and other photosynthetic proteins can contribute to the preservation of this endangered species and its unique evolutionary heritage.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.