Recombinant Cycas taitungensis Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Function

The Photosystem Q(B) protein (PSII D1 protein) is a core component of the PSII complex in thylakoid membranes. It facilitates electron transfer from the oxygen-evolving complex to the quinone acceptor plastoquinone (PQ), enabling light-driven water oxidation . Key identifiers include:

AttributeValue
GenepsbA
SynonymsPhotosystem II protein D1; 32 kDa thylakoid membrane protein
EC Number1.10.3.9
UniProt IDA6H5E4
SpeciesCycas taitungensis (Prince sago or Cycas taiwaniana)

The full-length protein (1–344 amino acids) includes domains critical for PSII assembly and function, such as the herbicide-binding pocket and transmembrane helices .

Production and Characterization

The recombinant protein is expressed in E. coli with an N-terminal His-tag for purification. Key production parameters include:

ParameterDetails
Expression HostE. coli
TagN-terminal His-tag
Purity>90% (SDS-PAGE confirmed)
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0
Storage-20°C/-80°C (lyophilized); aliquot recommended for repeated use

The amino acid sequence (MTAILEKRESASLWGRFCDWITSTENRLYIGWFGVLMIPTPLVATSVFIIAFIAAPPVYI…) confirms structural fidelity to the native protein .

Potential Uses

  • Functional Studies: Investigating herbicide resistance mechanisms or PSII repair pathways.

  • Structural Biology: Crystallization for X-ray diffraction studies.

  • Antibody Production: ELISA-based detection (e.g., in ).

Comparative Genomic Context

Transcriptome analyses of Cycas species (e.g., C. hainanensis) highlight psbA as a single-copy nuclear gene with low synonymous divergence, suggesting functional conservation .

Comparative Analysis with Other psbA Proteins

While specific studies on Cycas taitungensis are sparse, comparisons with homologs (e.g., Chlamydomonas, Pinus) reveal shared features:

SpeciesHost SystemPurityKey Applications
Cycas taitungensisE. coli>90%Herbicide binding, PSII repair
Chlamydomonas reinhardtiiE. coli/yeast≥85%Photosynthesis modeling
Pinus contortaE. coli/mammalian≥85%Coniferous plant studies

Data adapted from .

Handling and Stability

Critical considerations include:

  • Storage: Avoid repeated freeze-thaw cycles; store at -20°C/-80°C.

  • Reconstitution: Use deionized sterile water (0.1–1.0 mg/mL), with optional glycerol (5–50% final concentration) .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have a specific format requirement, please include it in your order notes. We will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us and we will prioritize its inclusion in the production process.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Cycas taitungensis (Prince sago) (Cycas taiwaniana)
Target Names
psbA
Target Protein Sequence
MTAILEKRESASLWGRFCDWITSTENRLYIGWFGVLMIPTPLVATSVFIIAFIAAPPVYI DGIREPVPGSLLYGNNIRYGAIIPTSAAIGLHLYPIWEAASVDGWHYYVGPYELIVMHLL LGVARYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGNFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANAGYKFG QEGETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAVWPVVGIWFTALGISTMAFNLNGF NFNQSVVDGQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H(2)O, generating O(2) and a proton gradient. This gradient is subsequently used for ATP formation. PSII comprises a core antenna complex that captures photons and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the Photosystem Q(B) protein in Cycas taitungensis and how does it relate to other photosystem components?

The term "Photosystem Q(B) protein" requires clarification as it may cause confusion in research contexts. In Photosystem II, QB refers to the exchangeable quinone molecule that functions as an electron acceptor rather than being a protein itself. The D2 protein (encoded by the psbD gene) in Photosystem II binds the quinone QA, which is why it carries the alternative name "Photosystem Q(A) protein" . The QB quinone primarily interacts with the D1 protein of Photosystem II. In Cycas taitungensis, the D2 protein has a full amino acid sequence of 353 residues as documented in UniProt (A6H5G6) .

Researchers should note that while working with Cycas photosystems, the nomenclature distinction between the quinone molecules (QA, QB) and the proteins that bind them (primarily D1 and D2) is crucial for experimental design and interpretation.

What is the role of QB in the electron transport chain of Photosystem II in Cycas species?

QB serves as an exchangeable quinone in Photosystem II that plays a critical role in the electron transport chain. The redox chemistry of QB is finely tuned to optimize photosynthetic function across diverse environmental conditions . In the electron transport process, QB accepts electrons sequentially, first becoming the semiquinone QB- −, and subsequently being further reduced to QBH2 .

The semiquinone form (QB- −) demonstrates remarkable thermodynamic stability with a relatively high redox potential, which provides two functional advantages: it minimizes back-reactions in the electron transport chain and prevents electrons from leaking onto O2, which would generate harmful reactive oxygen species . This explains the observed stability of the QB- − intermediate in photosynthetic systems.

The precise thermodynamic properties of the redox couples E(QB/QB- −) and E(QB- −/QBH2) are fundamental parameters for understanding Photosystem II function in Cycas species, though species-specific variations may exist that affect their performance under different environmental conditions .

What are the optimal storage conditions for recombinant Cycas taitungensis Photosystem proteins to maintain their activity?

Recombinant Photosystem proteins from Cycas taitungensis require specific storage conditions to preserve their structural integrity and functional activity. Based on established protocols for recombinant proteins from this species, the following storage parameters are recommended:

Storage PurposeTemperatureDurationBuffer Composition
Long-term storage-20°C or -80°CExtended periodsTris-based buffer with 50% glycerol
Working aliquots4°CUp to one weekSame as stock solution

Importantly, repeated freezing and thawing cycles should be strictly avoided as they can significantly compromise protein structure and activity . For experimental work requiring frequent access to the protein, researchers should prepare multiple small-volume aliquots rather than repeatedly freezing and thawing a single stock.

The buffer composition should be optimized specifically for the photosystem protein of interest, with Tris-based buffers containing 50% glycerol being a standard starting point for maintaining stability .

What spectroscopic techniques are most effective for studying QB redox states in Photosystem II of Cycas taitungensis?

The investigation of QB redox states in Photosystem II can be effectively conducted using several complementary spectroscopic approaches:

  • Electron Paramagnetic Resonance (EPR) spectroscopy is particularly valuable for detecting and characterizing the semiquinone QB- − intermediate. EPR signals arising from the semiquinone state can be used to measure both redox couples (QB/QB- − and QB- −/QBH2) .

  • Circular Dichroism (CD) spectroscopy in the visible range can provide insights into structural changes associated with different redox states. This technique has been successfully employed to study features attributable to carotenoids in photosystems .

  • Chlorophyll fluorescence measurements can indirectly monitor QB function by assessing parameters such as:

    • Fv/Fm (maximum quantum yield of PSII)

    • Y(II) (effective quantum yield)

    • qP (photochemical quenching coefficient)

    • rETR (relative electron transport rate)

    • Y(NO) (non-regulated non-photochemical energy loss)

    • Y(NPQ) (regulated non-photochemical energy loss)

Researchers should implement these techniques using appropriate controls and calibrations specific to Cycas taitungensis proteins to account for species-specific variations in photosystem structure and function.

How do the redox potentials of QB in Cycas compare with those in model photosynthetic organisms?

The redox properties of QB are critically important parameters that have been measured in model photosynthetic organisms but require specific investigation in Cycas species. The following table summarizes the key redox properties of QB in Photosystem II:

Redox CoupleThermodynamic PropertyFunctional Significance
E(QB/QB- −)Relatively high potentialMinimizes back-reactions
E(QB- −/QBH2)Thermodynamically favorable for QBH2 releaseOptimizes function with reduced plastoquinone pool
QB- − stateThermodynamically stablePrevents electron leakage to O2

While specific measurements for Cycas taitungensis are not directly provided in current literature, researchers investigating this species should conduct comparative redox potential measurements to determine whether evolutionary adaptations in this ancient plant lineage have resulted in different redox properties compared to angiosperms or cyanobacteria .

Methodologically, performing potentiometric titrations coupled with EPR spectroscopy would be the recommended approach for such comparative analyses.

How does temperature affect the function of Photosystem II in Cycas species, particularly with regard to QB dynamics?

Photosystem II is considered the most heat-sensitive component of the photosynthetic apparatus across plant species . Temperature effects on Photosystem II function, including QB dynamics, show distinct patterns across different Cycas species. Comparative studies between Cycas species have revealed significant differences in thermosensitivity.

For example, when comparing C. panzhihuaensis and C. multipinnata following heat stress and recovery, the following significant differences in photosynthetic parameters were observed:

ParameterC. multipinnataC. panzhihuaensisStatistical Significance
Fv/Fm (maximum quantum yield)HigherLowerSignificant (*)
Y(II) (effective quantum yield)HigherLowerSignificant (*)
qP (photochemical quenching)HigherLowerSignificant (*)
rETR (relative electron transport)HigherLowerSignificant (*)
Y(NO) (non-regulated energy loss)LowerHigherSignificant (*)
qN (non-photochemical quenching)LowerHigherSignificant (*)

These data demonstrate that while C. panzhihuaensis shows greater tolerance to freezing temperatures than other Cycas species, its photosynthetic apparatus, including QB dynamics, is more sensitive to heat stress . This species-specific variation has important implications for designing experiments involving temperature stress in Cycas taitungensis.

What experimental approaches can detect electron transfer between QA and QB in recombinant Cycas taitungensis Photosystem II proteins?

Advanced biophysical techniques that can effectively distinguish between electron transfer events to QA versus QB in Photosystem II include:

  • Time-Resolved Fluorescence Spectroscopy: This technique can monitor the quenching of chlorophyll fluorescence that occurs with different kinetics depending on whether electrons are transferred to QA or QB.

  • Transient Absorption Spectroscopy: Detects absorption changes on different time scales, with QA reduction occurring in the picosecond to nanosecond range and subsequent transfer to QB in the microsecond range.

  • EPR Spectroscopy with Specific Inhibitors: Using DCMU (3-(3,4-dichlorophenyl)-1,1-dimethylurea) to block electron transfer from QA to QB can help distinguish between these redox centers .

  • Site-Directed Mutagenesis: Though technically challenging with Cycas proteins, introducing specific mutations in the QB binding pocket of recombinant proteins can provide valuable insights into electron transfer dynamics.

When applying these techniques to Cycas taitungensis proteins, researchers should consider the potential for different kinetic properties compared to model organisms, as evolutionary adaptations in this ancient lineage may have resulted in altered electron transfer dynamics.

How can researchers study the interplay between Photosystem II function and environmental stress responses in Cycas species?

Investigating the relationship between Photosystem II function and environmental stress responses in Cycas species requires an integrated experimental approach:

  • Chlorophyll Fluorescence Measurements: Parameters such as Fv/Fm, Y(II), qP, rETR, Y(NO), Y(NPQ), and qN should be measured before and after stress treatments and during recovery periods to assess how environmental stressors affect Photosystem II function .

  • Experimental Design for Stress Studies:

    • Implement controlled stress treatments (temperature, light intensity, drought)

    • Monitor responses during stress application and recovery phases

    • Use two-way ANOVA to assess treatment effects, species differences, and their interactions

  • Carotenoid Composition Analysis: Changes in carotenoid profiles can provide insights into stress adaptation mechanisms. For example, in Synechocystis studies, PSI monomerization led to increased accumulation of myxoxantophyll, zeaxanthin, and echinenone regardless of temperature conditions . Similar analyses in Cycas would be valuable.

  • Morphological Analysis: Assess structural changes in thylakoid membranes and other cellular components in response to stress using electron microscopy .

This multi-faceted approach allows researchers to correlate biochemical changes at the level of the QB protein with broader physiological responses to environmental stress in these evolutionarily significant plant species.

What protein expression systems are most effective for producing functional recombinant Photosystem proteins from Cycas taitungensis?

Producing functional recombinant Photosystem proteins from Cycas taitungensis presents unique challenges due to their membrane-associated nature and complex cofactor requirements. While specific expression systems for Cycas proteins are not directly addressed in current literature, researchers should consider the following methodological approaches:

  • Expression System Selection:

    • E. coli-based systems can be used for initial expression trials but may require optimization for membrane proteins

    • Insect cell expression systems often provide better folding environments for complex plant proteins

    • Plant-based expression systems may be superior for maintaining native folding and cofactor incorporation

  • Construct Design Considerations:

    • Include the complete coding region (1-353 for D2 protein)

    • Consider codon optimization for the selected expression system

    • Evaluate tag placement carefully to avoid interfering with function

    • For QB-interacting proteins, ensure the QB binding pocket remains unperturbed

  • Purification Strategy:

    • Use gentle detergents appropriate for photosystem proteins

    • Include stabilizing agents such as glycerol in buffers

    • Consider incorporating cofactors during expression or reconstitution

While technically challenging, successful production of recombinant photosystem proteins from Cycas would provide valuable tools for comparative studies of this evolutionarily significant plant group.

What are the most effective validation methods to confirm the identity and purity of recombinant Cycas taitungensis Photosystem proteins?

Confirming the identity and purity of recombinant Photosystem proteins from Cycas taitungensis requires a comprehensive validation strategy:

  • Protein Identity Confirmation:

    • Mass spectrometry (MS) analysis for molecular weight verification and peptide mapping

    • Western blot using antibodies against conserved regions of photosystem proteins

    • N-terminal sequencing to confirm the start of the protein sequence

    • PCR verification of the expression construct using primers specific to the target gene

  • Purity Assessment:

    • SDS-PAGE with Coomassie or silver staining to evaluate protein homogeneity

    • Size exclusion chromatography to assess oligomeric state and aggregation

    • Dynamic light scattering to measure size distribution and potential aggregation

  • Functional Validation:

    • Spectroscopic measurements (absorption, fluorescence, CD) to confirm proper folding

    • Electron transfer assays using artificial electron donors/acceptors

    • Binding studies with quinones or specific inhibitors

    • Chlorophyll fluorescence measurements for assembled photosystems

A thorough validation protocol combining these approaches will ensure that the recombinant protein accurately represents the native Cycas taitungensis photosystem protein prior to detailed functional studies.

What insights into photosystem evolution can be gained from studying QB protein interactions in ancient plant lineages like Cycas?

As one of the most ancient extant seed plant lineages, Cycas species offer unique opportunities for studying the evolution of photosynthetic machinery:

  • Evolutionary Conservation of Redox Mechanisms:

    • The tuning of QB redox properties to optimize function appears to be a fundamental feature of photosynthetic organisms

    • Comparing these properties between Cycas and other plant groups can reveal which aspects of electron transport have remained conserved over hundreds of millions of years

  • Adaptive Variations:

    • Differences in QB binding, redox potential, or exchange rates between Cycas and other plant groups may reflect adaptations to specific environmental conditions

    • The relationship between these molecular adaptations and broader ecological traits of cycads would be particularly informative

  • Methodological Approaches:

    • Comparative genomic analysis of photosystem genes across plant lineages

    • Reconstruction of ancestral sequences to infer evolutionary trajectories

    • Biophysical characterization of QB interactions in representatives of major plant groups

    • Correlation of molecular properties with ecological adaptations and evolutionary history

Such evolutionary studies with Cycas photosystems can provide unique insights into the development of oxygenic photosynthesis across plant evolution while helping identify conserved functional elements that might represent design principles for artificial photosynthetic systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.