Recombinant Cyclorrhynchus psittacula NADH-ubiquinone oxidoreductase chain 6 (MT-ND6)

Shipped with Ice Packs
In Stock

Description

Production and Quality Control

The protein is expressed in E. coli, purified via affinity chromatography, and validated for homogeneity (>90% purity) . Key handling protocols include:

  • Storage: -20°C/-80°C (long-term); 4°C (short-term working aliquots) .

  • Reconstitution: Optimized in sterile water with 50% glycerol to prevent aggregation .

  • Stability: Avoid repeated freeze-thaw cycles to maintain structural integrity .

Functional Role in Mitochondrial Complex I

MT-ND6 is a core subunit of Complex I, essential for:

  • Electron Transfer: Mediates NADH → ubiquinone electron transport .

  • Proton Pumping: Facilitates conformational changes in the enzyme’s membrane arm .

  • Assembly: Critical for integrating mtDNA-encoded subunits into Complex I .

Pathogenic Implications

  • Mutations in MT-ND6 (e.g., m.14487T>C) are linked to mitochondrial diseases like Leigh syndrome but require modifier genes for phenotypic expression .

  • Homozygous ND6 variants correlate with reduced sperm fertilization capacity in IVF studies .

Biochemical Assays

  • Used in SDS-PAGE and activity assays to study Complex I dysfunction .

  • ELISA kits (e.g., CSB-EL015082HU) detect MT-ND6 in human serum/plasma with a sensitivity of 5.86 pg/mL .

Disease Modeling

  • Methylation of MT-ND6 in non-alcoholic steatohepatitis (NASH) correlates with reduced mRNA expression and mitochondrial dysfunction .

Recent Findings and Future Directions

  • Mechanistic Insights: ND6 stabilizes the open conformation of Complex I during catalysis, influencing proton-pumping efficiency .

  • Therapeutic Targets: ND6 mutations are being explored for gene therapy in mitochondrial disorders .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format we currently have in stock, we are happy to accommodate your specific requirements. Please indicate your preferred format in the order notes, and we will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timeframes, please consult your local distributors.
Note: Our standard shipping practice involves packaging with blue ice packs. Should you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50% and can be used as a reference for your own preparations.
Shelf Life
The shelf life is dependent on various factors including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself. Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is necessary. Repeated freeze-thaw cycles should be avoided.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please let us know and we will prioritize developing the specified tag.
Synonyms
MT-ND6; MTND6; NADH6; ND6; NADH-ubiquinone oxidoreductase chain 6; NADH dehydrogenase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-173
Protein Length
full length protein
Species
Aethia psittacula (Parakeet auklet) (Cyclorrhynchus psittacula)
Target Names
Target Protein Sequence
MTYFVLFLGLCFVLGGLAVASNPSPYYGVVGLVLASVAGCGWLLSLGVSFVSLVLFMVYL GGMLVVFVYSVSLAADPFPEAWGDWGVVGYGVGFVVVLVAGLIVGGSIGSLDFGVVTVDS VGMFSVRLDFGGVAMFYSCGVGMLLVAGWGLLLTLFVVLELVRGLSRGAIRAV
Uniprot No.

Target Background

Function
This protein represents the core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is believed to be essential for the minimal assembly required for catalysis. Complex I plays a vital role in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is thought to be ubiquinone.
Protein Families
Complex I subunit 6 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is MT-ND6 and what is its role in mitochondrial function?

MT-ND6 (Mitochondrially encoded NADH:ubiquinone oxidoreductase core subunit 6) is a gene that provides instructions for making the NADH dehydrogenase 6 protein. This protein is an essential component of Complex I in the mitochondrial respiratory chain. Within mitochondria, Complex I is embedded in the inner mitochondrial membrane and participates in oxidative phosphorylation, the process that generates ATP, the cell's main energy source .

The MT-ND6 protein specifically functions in the first step of the electron transport process, facilitating the transfer of electrons from NADH to ubiquinone. This electron transfer helps create an unequal electrical charge across the inner mitochondrial membrane, providing the energy necessary for ATP production . In Cyclorrhynchus psittacula, as in other species, proper MT-ND6 function is critical for cellular energy metabolism.

Why would researchers choose to work with recombinant MT-ND6 rather than native protein?

Recombinant MT-ND6 offers several methodological advantages for research:

  • Controlled expression levels allow production of sufficient quantities for structural and functional studies

  • Addition of purification tags facilitates isolation of this highly hydrophobic membrane protein

  • Site-directed mutagenesis enables systematic investigation of structure-function relationships

  • Homogeneous protein preparation improves reproducibility in biochemical assays

  • Expression in different systems allows optimization of protein folding and stability

Native MT-ND6 exists within the multisubunit Complex I, making it challenging to study in isolation. Recombinant expression provides a way to produce the protein for targeted investigations of its properties and interactions with other Complex I components .

What expression systems are most suitable for producing recombinant MT-ND6?

Expressing recombinant MT-ND6 presents challenges due to its hydrophobic nature and mitochondrial origin. A systematic comparison of expression systems reveals:

Expression SystemAdvantagesLimitationsRecommended Applications
E. coliCost-effective, high yieldInclusion body formation, refolding requiredMutational analysis, antibody production
Yeast (P. pastoris)Eukaryotic processing, membrane integrationLower yields than bacteriaFunctional studies requiring proper folding
Insect cellsAdvanced post-translational modificationsMore complex, moderate costStructural studies, protein-protein interactions
Mammalian cellsNative-like environmentHighest cost, lowest yieldStudies requiring authentic processing
Cell-free systemsAvoids toxicity issuesLimited scaleExpression of toxic variants

For optimal results with Cyclorrhynchus psittacula MT-ND6, researchers should consider:

  • Codon optimization for the chosen expression system

  • Addition of solubility-enhancing fusion partners

  • Expression at lower temperatures to improve folding

  • Use of detergents or membrane-mimetic systems for solubilization

  • Purification under conditions that maintain native-like structure

How should researchers design molecular dynamics simulations to study MT-ND6 structure-function relationships?

Molecular dynamics (MD) simulations provide critical insights into MT-ND6 behavior that experimental approaches cannot directly reveal. An effective MD workflow includes:

  • Structure preparation: Begin with CryoEM structures or homology models based on related species if Cyclorrhynchus psittacula structures are unavailable

  • System setup: Place protein in a membrane environment using lipid compositions that mimic the inner mitochondrial membrane

  • Simulation parameters: Run simulations using appropriate force fields (e.g., AMBER99SB) for at least 200 ns to capture relevant conformational changes

  • Analysis metrics:

    • Root Mean Square Fluctuation (RMSF) to identify mobile regions

    • Solvent Accessible Surface Area (SASA) to assess protein compactness

    • Native contact preservation to quantify structural stability

    • Interface analysis to examine interactions with other Complex I subunits

Studies on truncated ND6 variants demonstrate how MD simulations can reveal that mutations cause conformational rearrangements rather than complete unfolding, with approximately 25% loss of native contacts while maintaining a stable alternative conformation .

What methods are most effective for validating the pathogenicity of MT-ND6 mutations?

Establishing causality for MT-ND6 mutations requires a multi-faceted approach combining genetic, biochemical, and functional analyses:

  • Conservation analysis: Assess evolutionary conservation of the affected amino acid position across species, as demonstrated for the Pro79Ser mutation in MT-ND6

  • Biochemical assays: Measure Complex I enzyme activity in patient samples to quantify functional impact

  • Cybrid studies: Transfer mitochondria containing the mutation into cells lacking mtDNA (ρ0 cells) to isolate the effect of the mitochondrial mutation from nuclear factors

  • Blue Native PAGE: Evaluate Complex I assembly and stability to distinguish between assembly defects and intrinsic activity defects

  • Molecular dynamics: Simulate the effects of mutations on protein structure and dynamics

This integrated approach has successfully validated pathogenic mutations like m.14439G>A, which was confirmed through cybrid studies showing consistent reduction in complex I activity compared to the original patient's fibroblasts .

How can researchers effectively isolate and purify recombinant MT-ND6 while maintaining its functional properties?

Purification of MT-ND6 requires specialized approaches due to its hydrophobic nature:

StageMethodologyCritical ConsiderationsQuality Control
SolubilizationDetergent screening (DDM, LMNG, etc.)Maintain protein-lipid interactionsSEC profile, thermal stability
ExtractionGentle cell lysisPreserve membrane integrityMicroscopy verification
PurificationAffinity chromatography using fusion tagsOptimize buffer conditionsSDS-PAGE, Western blot
StabilizationTransfer to membrane mimeticsMatch native environmentActivity assays
Final polishingSize exclusion chromatographyRemove aggregates and impuritiesDynamic light scattering

For Cyclorrhynchus psittacula MT-ND6, researchers should:

  • Test multiple detergent classes to identify optimal solubilization conditions

  • Consider nanodiscs or amphipols for long-term stability

  • Validate protein functionality at each purification step

  • Optimize conditions based on the intended downstream applications

How do experimental approaches differ when studying recombinant MT-ND6 across different species?

Working with MT-ND6 from different species requires consideration of evolutionary and physiological adaptations:

  • Sequence optimization: Codon usage differs substantially between species, requiring optimization for the chosen expression system while preserving critical structural features

  • Functional assessment: Enzymatic assays must account for species-specific parameters:

    • Adjust temperature conditions to match the physiological range of the source organism

    • Consider pH optima differences between marine species like Cyclorrhynchus psittacula and terrestrial organisms

    • Validate antibody cross-reactivity for detection methods

  • Comparative analysis: Utilize sequence alignment to identify:

    • Conserved domains that likely maintain critical functions

    • Variable regions that may reflect species-specific adaptations

    • Sites under selection pressure that could impact protein stability

  • Structural considerations: Models should account for species-specific post-translational modifications and protein-protein interactions within Complex I

How can researchers distinguish between assembly defects and intrinsic activity defects when studying MT-ND6 mutations?

Distinguishing between these defect types requires complementary analytical approaches:

  • Blue Native PAGE analysis:

    • Separate intact respiratory complexes under native conditions

    • Identify subcomplexes indicating assembly defects

    • Perform in-gel activity assays to assess function of assembled complexes

  • Complementary analytical techniques:

    • Immunodetection of assembly intermediates and factors

    • Supercomplex analysis to assess higher-order organization

    • Crosslinking mass spectrometry to map subunit interactions

  • Systematic analytical workflow:

    • Compare total MT-ND6 protein levels by Western blot

    • Assess Complex I assembly state

    • Measure electron transfer activity in assembled complexes

    • Correlate assembly state with functional measurements

Studies of truncated ND6 variants demonstrate how mutations can affect both assembly and activity, requiring these approaches to distinguish the primary defect mechanism .

What are the most informative spectroscopic and biophysical techniques for studying MT-ND6 function?

Several advanced techniques provide insights into MT-ND6 structure and function:

TechniqueInformation ProvidedExperimental Considerations
EPR SpectroscopyElectron transfer kinetics, iron-sulfur cluster statesRequires purified Complex I or submitochondrial particles
FTIR SpectroscopyProton pumping, conformational changesCan be applied to reconstituted proteoliposomes
Hydrogen/Deuterium Exchange MSConformational dynamics, solvent accessibilityRequires optimization for membrane proteins
Thermal Shift AssaysProtein stability, ligand bindingDetergent background can complicate analysis
Single-molecule FRETDynamic structural changes during catalysisRequires site-specific labeling

For comprehensive analysis of Cyclorrhynchus psittacula MT-ND6, researchers should:

  • Combine multiple spectroscopic approaches to build a complete functional picture

  • Compare results between recombinant protein and native Complex I

  • Consider species-specific adaptations that might influence spectroscopic properties

How do MT-ND6 mutations contribute to mitochondrial disease pathogenesis?

MT-ND6 mutations can lead to mitochondrial diseases through several mechanisms:

  • Primary biochemical consequences:

    • Reduced Complex I assembly and stability

    • Decreased electron transfer efficiency

    • Increased reactive oxygen species production

    • Impaired ATP synthesis

  • Clinical manifestations:

    • Specific MT-ND6 mutations like m.14439G>A cause Leigh syndrome by altering a highly conserved proline residue (Pro79Ser)

    • Other mutations are associated with Leber hereditary optic neuropathy, an inherited form of vision loss

    • Some truncating mutations have been identified in tumor tissues, suggesting a role in cellular transformation

  • Tissue-specific effects:

    • Tissues with high energy demands (brain, retina, heart) are particularly vulnerable

    • The degree of heteroplasmy (proportion of mutant mtDNA) influences disease severity

  • Research methodologies for pathogenesis studies:

    • Patient-derived fibroblast analysis for biochemical defects

    • Cybrid studies to confirm mitochondrial DNA causality

    • Molecular dynamics to predict structural consequences of mutations

What considerations are important when designing experiments to test potential therapeutic approaches for MT-ND6 dysfunction?

Therapeutic intervention studies require careful experimental design:

  • Model system selection:

    • Cellular models: Patient-derived fibroblasts, cybrid cells, or induced pluripotent stem cells

    • Animal models: Consider species-specific differences in mitochondrial function

    • Tissue specificity: Focus on tissues most affected in the disease state

  • Therapeutic approach categories:

    • Bypass therapeutics: Alternative electron carriers that bypass Complex I

    • Stabilizing compounds: Small molecules that improve mutant MT-ND6 stability

    • Metabolic modifiers: Agents that enhance alternative energy pathways

  • Experimental design essentials:

    • Include appropriate controls (positive, negative, vehicle)

    • Test dose-response relationships

    • Assess multiple endpoints (ATP production, oxygen consumption, ROS levels)

    • Evaluate long-term effects and potential toxicity

  • Translational considerations:

    • Bioavailability to mitochondria

    • Blood-brain barrier penetration for neurological manifestations

    • Heteroplasmy modulation potential

How can integrating computational and experimental approaches enhance MT-ND6 mutation characterization?

An integrated computational-experimental workflow maximizes insights into MT-ND6 mutations:

  • Computational prediction phase:

    • Homology modeling of wildtype and mutant structures

    • Molecular dynamics simulations to predict stability changes (300K temperature, 200ns minimum simulation time)

    • Evolutionary conservation analysis across species

    • In silico prediction of mutation effects on electron transfer pathways

  • Experimental validation phase:

    • Site-directed mutagenesis to introduce predicted mutations

    • Spectroscopic analysis of electron transfer kinetics

    • Thermal stability assays to validate computational stability predictions

    • Hydrogen/deuterium exchange to verify predicted conformational changes

  • Integration methodology:

    • Generate computational hypotheses about mutation effects

    • Design targeted experiments to test specific predictions

    • Refine computational models based on experimental results

    • Develop quantitative structure-function relationships

This iterative approach has successfully characterized mutations like those resulting in truncated ND6, where molecular dynamics predictions about protein stability were confirmed by experimental observations .

What are the challenges and solutions for studying MT-ND6 interactions within the complete respiratory chain supercomplex?

Investigating MT-ND6 in its native supercomplex environment presents unique challenges:

ChallengeTechnical ApproachAnalytical Consideration
Preserving native interactionsMild solubilization with digitoninOptimize detergent:protein ratio
Maintaining functional stateOn-column activity assaysMonitor activity throughout purification
Resolving structural detailsCryo-electron microscopyConsider local resolution around MT-ND6
Detecting conformational changesCrosslinking mass spectrometryDesign crosslinkers accessible to membrane proteins
Assessing supercomplex dynamicsNative mass spectrometryRequires specialized instrumentation for membrane complexes

Researchers studying Cyclorrhynchus psittacula MT-ND6 within supercomplexes should:

  • Compare supercomplex organization with well-characterized model organisms

  • Assess whether species-specific adaptations affect supercomplex stability

  • Consider environmental factors (temperature, salinity) that might influence assembly

  • Develop protocols that maintain physiologically relevant conditions throughout analysis

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.