Recombinant Cydia pomonella granulosis virus Occlusion-derived virus envelope protein E56 (odv-e56)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, and can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
odv-e56; 18; Occlusion-derived virus envelope protein E56; ODV-E56; ODVP-6E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-355
Protein Length
full length protein
Species
Cydia pomonella granulosis virus (isolate Mexico/1963) (CpGV) (Cydia pomonella granulovirus)
Target Names
odv-e56
Target Protein Sequence
MSFFRGLRRTNKVYNDPSGFITDHAQLIRNQTPAGFNLNNPTTMGLANGTYVPGYNINGA FISNTNVNTVLRNNDVVGMRQLFPDASNNQMNGLTNLRRADNIPDATLHGLQTRKNGVKT SHPETAVRDRVGVENALAQNPRLADYLRGAGYVTLFGVSVYLVINVADLVSSIVEALNRT GGSWYYRGNNGGDNFSNIDACVLRYRSCGMSLADIDEFVCELDPHDPNNVDPLLSFDEAR NFCNGYSLAAEGSVCRGSDTNADPSTLQYLDISELEPNQTVQCVEPYDFGDLIGDLGLDW LLGENGFVTASSNSLTSVSNNFTTILLVIGGILLLTFIGFVIFKVVNRSSNNNTS
Uniprot No.

Target Background

Function

Structural protein specific to occlusion-derived virus (ODV) envelopes, but not budded virus (BV) envelopes.

Database Links

KEGG: vg:921349

Protein Families
Baculoviridae E56 family
Subcellular Location
Virion membrane; Multi-pass membrane protein.

Q&A

What is ODV-E56 and what is its fundamental role in baculoviruses?

ODV-E56 is an occlusion-derived virus (ODV)-specific envelope protein found in various baculoviruses, including Autographa californica multiple nucleopolyhedrovirus (AcMNPV), Bombyx mori nucleopolyhedrovirus (BmNPV), and Cydia pomonella granulovirus (CpGV). The protein is encoded by the odv-e56 gene, which has been characterized as a late gene in the viral replication cycle .

The primary function of ODV-E56 appears to be mediating oral infectivity in host larvae. Research has demonstrated that this protein is essential for the initiation of primary infection through the per os (oral) route, although it is not required for the production of infectious budded virus (BV) or for systemic infection once the virus has entered the host cells . This protein's conservation across baculovirus species suggests its critical evolutionary importance for viral transmission in nature.

What experimental evidence demonstrates ODV-E56's role in viral infectivity?

Multiple studies have employed gene deletion and replacement strategies to elucidate ODV-E56's function. When the odv-e56 gene is deleted from AcMNPV or BmNPV, the resulting mutant viruses show profoundly impaired oral infectivity compared to wild-type viruses .

In BmNPV studies, when 3rd-instar B. mori larvae were orally inoculated with polyhedra (20,000 polyhedra/larvae) of odv-e56-deleted virus (BmE56D), only 15.6% mortality was observed. In contrast, wild-type BmNPV and the rescue virus (BmE56DR) killed 95.6% and 93.3% of the larvae, respectively . Similar results were obtained with lower doses of polyhedra, consistently demonstrating ODV-E56's critical role in oral infection.

Importantly, when virus was administered by direct hemocoel injection (bypassing the midgut barrier), the odv-e56 deletion mutants retained full virulence, confirming that ODV-E56's role is specific to the initial oral infection process rather than subsequent systemic infection .

How can researchers assess the impact of ODV-E56 modifications on viral replication and morphogenesis?

Several methodological approaches have proven effective for evaluating how modifications to ODV-E56 affect viral biology:

  • Quantitative real-time PCR analysis: This technique can assess viral DNA replication kinetics in infected cell cultures. Studies with BmNPV showed no significant differences in viral DNA accumulation between wild-type, odv-e56 deletion mutant, and rescue viruses at various time points post-infection .

  • TCID50 endpoint dilution assays: These assays determine infectious budded virus titers. Research demonstrated equivalent production of infectious BV by wild-type and odv-e56 mutant viruses, confirming that ODV-E56 is not required for BV production .

  • Electron microscopy: This technique enables direct visualization of virus morphogenesis and occlusion body formation. Electron micrographs of odv-e56 mutant viruses revealed normal polyhedra morphogenesis and ODV assembly, indicating ODV-E56 is not essential for these processes .

  • Bioassays with lepidopteran hosts: These in vivo experiments assess virulence through both oral infection (polyhedra administration) and direct hemocoel injection, providing critical information about stage-specific functions of viral proteins like ODV-E56 .

What is currently understood about ODV-E56's relationship to baculovirus host range?

Previous evolutionary analysis identified the odv-e56 gene as being under positive selection pressure, suggesting it may function as a determinant of virus host range . This hypothesis led researchers to investigate whether replacing the odv-e56 gene from one viral species with that of another could alter host specificity or virulence.

In experiments where the AcMNPV odv-e56 gene was replaced with its ortholog from Rachiplusia ou multiple nucleopolyhedrovirus (RoMNPV) (a virus more virulent toward some host species), the recombinant viruses (Ac69GFP-Roe56) did not show increased virulence against tested host species. The recombinant virus killed larvae with LC50 values similar to those of viruses expressing the original AcMNPV ODV-E56 .

These findings suggest that while ODV-E56 is essential for oral infectivity, other factors may work in conjunction with ODV-E56 to determine host range specificity. The relationship between ODV-E56 sequence variation and host range remains an active area of investigation.

What molecular mechanisms underlie ODV-E56's role in mediating oral infectivity?

The precise molecular mechanisms through which ODV-E56 facilitates oral infection remain incompletely understood, presenting an important frontier for advanced research. Current evidence suggests several potential mechanisms:

  • Midgut binding and fusion: ODV-E56 likely participates in the initial binding of ODVs to midgut epithelial cells or in subsequent fusion events. The protein's predicted structural features include membrane-spanning domains, which may facilitate these processes.

  • Protection against midgut proteases: ODV-E56 may help protect virions from degradation by host digestive enzymes during the initial phase of infection. Researchers investigating this hypothesis might employ protease sensitivity assays comparing wild-type and odv-e56 deleted virions.

  • Interaction with host receptors: The specificity of ODV-E56 may derive from interactions with host-specific receptors in the midgut. Protein binding assays and co-immunoprecipitation studies could potentially identify these interaction partners.

To elucidate these mechanisms, researchers might employ techniques such as:

  • Site-directed mutagenesis to identify functional domains

  • Immunolocalization to track ODV-E56 during early infection stages

  • Protein-protein interaction studies to identify binding partners

  • Comparative studies across different host-virus systems

How can recombinant ODV-E56 be optimally produced and characterized for structural studies?

Recombinant ODV-E56 production presents several methodological considerations for researchers seeking to conduct structural studies or functional assays. Based on available information, a recombinant full-length CpGV ODV-E56 protein (355 amino acids) with an N-terminal His-tag has been successfully expressed in E. coli .

The recombinant protein production protocol involves:

  • Expression of the full ODV-E56 sequence (amino acids 1-355) in E. coli

  • Purification using affinity chromatography (likely His-tag based)

  • Preparation as a lyophilized powder

  • Storage in Tris/PBS-based buffer containing 6% Trehalose at pH 8.0

For optimal handling of recombinant ODV-E56:

  • Brief centrifugation prior to opening is recommended

  • Reconstitution in deionized sterile water to 0.1-1.0 mg/mL concentration

  • Storage of working aliquots at 4°C for up to one week

  • Long-term storage at -20°C/-80°C

  • Avoidance of repeated freeze-thaw cycles

Researchers should validate recombinant protein authenticity through:

  • SDS-PAGE to confirm purity (>90% recommended)

  • Western blotting with anti-ODV-E56 antibodies

  • Mass spectrometry for precise molecular weight determination

  • Functional binding assays to verify biological activity

What approaches are effective for studying ODV-E56 evolutionary dynamics and variation?

The observation that odv-e56 is under positive selection pressure suggests evolutionary significance worth further investigation . Advanced research in this area might employ:

  • Comparative genomics: Analyzing odv-e56 sequences across diverse baculovirus isolates can reveal patterns of conservation and variation. Researchers should focus on:

    • Identifying highly conserved domains (likely functional importance)

    • Pinpointing variable regions that may relate to host adaptation

    • Comparing synonymous vs. non-synonymous substitution rates

  • Phylogenetic analysis: Constructing phylogenetic trees based on odv-e56 sequences can reveal evolutionary relationships and potential horizontal gene transfer events among baculoviruses.

  • Structure-function correlation: Mapping sequence variations onto predicted protein structures can generate hypotheses about functional significance of specific regions.

  • Experimental evolution: Passaging baculoviruses through alternate hosts under selective pressure could reveal adaptive changes in the odv-e56 gene, which can be tracked through next-generation sequencing.

  • Recombinant virus construction: As demonstrated with AcMNPV and RoMNPV odv-e56 genes, creating chimeric viruses with odv-e56 genes from different sources allows direct testing of evolutionary hypotheses .

What methodological strategies can overcome challenges in studying ODV-E56 in resistant host populations?

The emergence of field resistance to CpGV presents both challenges and research opportunities . Researchers investigating ODV-E56's role in this context might consider:

  • Resistance profiling: Characterizing the susceptibility of different host strains to recombinant viruses with modified ODV-E56 proteins can reveal resistance mechanisms. This approach should include:

    • Dose-response bioassays comparing susceptible and resistant hosts

    • Comparison of ODV binding and fusion in midgut cells from resistant vs. susceptible hosts

    • Transcriptomic analysis of midgut tissue from resistant hosts to identify altered receptor expression

  • Selection experiments: Laboratory selection for resistance followed by genomic and transcriptomic analysis can identify host factors that interact with ODV-E56.

  • Combination approaches: Since ODV-E56 is one of several per os infectivity factors, examining combinations of modified PIFs may provide insights into overcoming resistance.

  • Advanced microscopy: Techniques such as super-resolution microscopy or correlative light and electron microscopy can track the fate of labeled ODV-E56 during infection attempts in resistant hosts.

How can researchers effectively design experiments to elucidate interactions between ODV-E56 and other viral envelope proteins?

Understanding how ODV-E56 functions within the context of the ODV envelope requires investigating its interactions with other viral proteins. Effective experimental approaches include:

  • Co-immunoprecipitation assays: Using antibodies against ODV-E56 to pull down interacting partners, followed by mass spectrometry identification.

  • Proximity labeling: Techniques such as BioID or APEX2 fusion to ODV-E56 can identify proteins in close proximity during virion assembly.

  • Fluorescence resonance energy transfer (FRET): By tagging ODV-E56 and candidate interacting proteins with appropriate fluorophore pairs, researchers can detect direct protein-protein interactions in living cells.

  • Cryo-electron microscopy: This technique can potentially resolve the spatial arrangement of ODV-E56 relative to other envelope proteins within intact virions.

  • Genetic complementation studies: Testing whether mutations in other envelope proteins can be complemented by modifications to ODV-E56 may reveal functional relationships.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.