Recombinant Cynops pyrrhogaster Protein patched homolog 2 (PTC2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
PTC2; Protein patched homolog 2; PTC2; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-255
Protein Length
full length protein
Species
Cynops pyrrhogaster (Japanese fire-bellied newt)
Target Names
PTC2
Target Protein Sequence
SLLQGGSAYLPGRPEIQWKNLNPMQLMEELGQFTSVDGFKEMLDKADVGQAYMERPCLDP MDPQCPESAPNKQKRRVPNIAQELAGGCYGFSKRFMHWQEELILGGTVRDSQDRLLSAEA LQTMFLLMSSRQLYEHFRDNYEIHDINWTEEKAAAILETWQRKFVELAQQSAPENSSQII HAFSTTTLNDIMKSFSDVSVIRVAGGYLLMLAYACVTMLRWDCTKSQGAVGLAGVLLVAL SVASGLGLCSLLGIS
Uniprot No.

Target Background

Function
May function as a sonic hedgehog (SHH) receptor.
Protein Families
Patched family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
In the eye, detected in neural retina, iris, retinal pigment epithelium, but not in lens.

Q&A

What is Protein patched homolog 2 (PTC2) and what is its biological significance?

Protein patched homolog 2 (PTC2) is a transmembrane protein encoded by the PTC2 gene in Cynops pyrrhogaster (Japanese common newt). It belongs to the Patched family of proteins that function as receptors in the Hedgehog signaling pathway . The biological significance of PTC2 stems from its role in developmental processes and tissue patterning through its interaction with Hedgehog ligands. In the absence of Hedgehog ligand, Patched acts as a signal repressor by inhibiting the transducing molecule Smoothened (Smo), thereby preventing pathway activation until Hedgehog reception occurs .

The full-length PTC2 protein from Cynops pyrrhogaster consists of 255 amino acids and has been assigned the UniProt identification number O42334 . Understanding this protein's function is particularly valuable for comparative studies of evolutionary conservation in signaling pathways across vertebrate species and for investigating tissue regeneration mechanisms that are especially prominent in amphibians like the Japanese newt.

What are the optimal storage and handling conditions for recombinant PTC2?

Proper storage and handling of recombinant PTC2 is critical for maintaining its structural integrity and biological activity. The recommended storage conditions are:

ParameterRecommendation
Long-term storage-20°C or -80°C
Working stock4°C for up to one week
FormLyophilized powder or in storage buffer
Storage bufferTris-based buffer with 50% glycerol (commercial) or Tris/PBS-based buffer with 6% Trehalose, pH 8.0
Freeze-thaw cyclesMinimize; repeated freezing and thawing is not recommended
AliquotingNecessary for multiple use to avoid repeated freeze-thaw cycles

For reconstitution of lyophilized PTC2, it is recommended to:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (commonly 50%) for long-term storage

These storage and handling practices are designed to preserve protein stability and prevent degradation that could compromise experimental results. Researchers should always verify protein activity after extended storage periods using appropriate functional assays.

What expression systems are used for producing recombinant Cynops pyrrhogaster PTC2?

The primary expression system used for producing recombinant Cynops pyrrhogaster PTC2 is Escherichia coli (E. coli). This bacterial expression system offers several advantages for protein production, including:

  • High yield potential

  • Well-established protocols

  • Relatively low cost

  • Ease of genetic manipulation

  • Rapid growth and protein expression

When expressed in E. coli, recombinant PTC2 is typically fused to an N-terminal His-tag to facilitate purification through affinity chromatography . The His-tagged protein can be purified to greater than 90% purity as determined by SDS-PAGE analysis .

While E. coli is the most commonly documented expression system for PTC2, researchers investigating protein-protein interactions or post-translational modifications might consider alternative expression systems such as insect cells (Sf9, Sf21) or mammalian cell lines that provide more appropriate eukaryotic processing machinery.

What methodological approaches can be used to study PTC2's role in tissue regeneration?

Studying PTC2's role in tissue regeneration, particularly in Cynops pyrrhogaster, requires a multifaceted experimental approach:

Methodological ApproachDescriptionApplication to PTC2 Research
Transgenic ModelsGeneration of transgenic newts using techniques like I-SceI-mediated transgenesisCan be used to express modified versions of PTC2 or fluorescently-tagged PTC2 to track its expression and localization during regeneration
Gene Expression AnalysisRT-PCR, qPCR, RNA-seq to measure gene expression levelsSimilar to the approach used to study POU class V family genes in C. pyrrhogaster during limb regeneration
ImmunohistochemistryProtein localization in tissue sectionsCan reveal spatial distribution of PTC2 during different phases of regeneration
Loss-of-Function StudiesCRISPR/Cas9, morpholinos, or dominant negative constructsCan determine the necessity of PTC2 in regenerative processes
Gain-of-Function StudiesOverexpression of PTC2 or constitutively active constructsCan assess whether PTC2 is sufficient to induce or enhance regeneration
Protein-Protein Interaction StudiesCo-immunoprecipitation, proximity ligation assayCan identify binding partners of PTC2 during regeneration
Live ImagingConfocal microscopy with fluorescently tagged proteinsCan visualize dynamic changes in PTC2 localization during regeneration

A regeneration experiment using larval forelimb can reveal temporal gene expression patterns, similar to studies of POU class V family genes which showed transient gene expression during wound healing followed by activation during blastema formation . This temporal regulation suggests that studying PTC2 expression at different time points during regeneration is crucial for understanding its role in this process.

How can researchers effectively use recombinant PTC2 in receptor-ligand binding assays?

Designing receptor-ligand binding assays for studying interactions between recombinant PTC2 and Hedgehog ligands requires careful methodology:

  • Protein Preparation:

    • Ensure recombinant PTC2 is properly folded by using appropriate expression systems

    • Consider using membrane fractions or reconstituting purified PTC2 in liposomes to maintain native conformation

    • Verify protein activity before binding assays

  • Binding Assay Methods:

    • Surface Plasmon Resonance (SPR): Immobilize either PTC2 or Hh ligand on a sensor chip and measure real-time binding kinetics

    • ELISA-based assays: Coat plates with PTC2 and detect binding of labeled Hh ligands

    • Pull-down assays: Use His-tagged PTC2 (as available from commercial sources ) for affinity-based pull-downs with potential binding partners

    • Fluorescence-based assays: Label either PTC2 or ligand with fluorescent tags and measure binding through changes in fluorescence intensity or polarization

  • Controls and Validation:

    • Include positive controls (known interacting proteins) and negative controls (non-binding proteins)

    • Validate binding with multiple independent methods

    • Test binding under various conditions (pH, salt concentration) to determine optimal interaction parameters

  • Data Analysis:

    • Determine binding kinetics (kon, koff) and equilibrium dissociation constant (KD)

    • Compare binding parameters across different experimental conditions or with mutated versions of the proteins

For researchers specifically working with Cynops pyrrhogaster PTC2, the recombinant protein with N-terminal His-tag expressed in E. coli could be used directly in pull-down assays to identify interacting proteins from newt tissue lysates, potentially revealing novel binding partners involved in regeneration processes .

What are the key structural and functional differences between PTC2 and other Patched family proteins?

Comparison of Cynops pyrrhogaster PTC2 with other Patched family proteins reveals important evolutionary and functional insights:

FeatureCynops pyrrhogaster PTC2Other Patched Family ProteinsFunctional Implications
Protein Size255 amino acids (may represent a functional domain rather than full-length protein)Mammalian Ptch1: ~1400 aa; Drosophila Ptc: ~1300 aaMay indicate specialized function or represent a conserved functional domain
Membrane TopologySequence suggests membrane-associated regionsTypically 12 transmembrane domains in full-length Patched proteins Differences may affect ligand binding and signal transduction
Conserved DomainsContains regions critical for Hh bindingSterol sensing domain (SSD) present in many Patched proteinsMay reflect evolutionary adaptation to specific Hh ligands
Expression PatternNot fully characterized in C. pyrrhogasterTissue-specific expression patterns in mammalsPotential specialized roles in amphibian development and regeneration
Functional RedundancyUnknown in C. pyrrhogasterMammalian Ptch1 and Ptch2 show partial functional redundancyMay provide insights into evolutionary conservation of Hh pathway

Structurally, the available sequence information for Cynops pyrrhogaster PTC2 (255 amino acids) suggests it may represent a specific domain or a partial sequence of the full protein . Full-length Patched proteins in other organisms typically contain 12 transmembrane domains and are considerably larger (~1300-1400 amino acids).

Further comparative analysis using bioinformatic approaches could help identify conserved functional motifs and predict structural features of PTC2. This would be valuable for researchers designing experiments to probe specific aspects of PTC2 function or developing targeted reagents like antibodies or small molecule modulators.

What techniques can be used to investigate PTC2 trafficking and localization in cells?

Investigating PTC2 trafficking and localization in cells requires sophisticated imaging and biochemical techniques:

  • Fluorescent Protein Tagging:

    • Generate expression constructs with PTC2 fused to fluorescent proteins (GFP, mCherry)

    • This approach allows for live-cell imaging of protein movement

    • Can be implemented in Cynops pyrrhogaster cells using techniques similar to those used for the RPE65 promoter study

  • Split-GFP Complementation Assay:

    • Similar to the approach used in Drosophila Patched studies, where discrete GFP-positive dots were observed along Hedgehog-sending cytonemes

    • Involves expressing PTC2 fused to one part of a split GFP and a binding partner fused to the complementary GFP fragment

    • Enables visualization of protein-protein interactions in situ

  • Subcellular Fractionation:

    • Biochemical separation of different cellular compartments followed by Western blot analysis

    • Can determine the distribution of PTC2 among membrane, cytosolic, and vesicular fractions

  • Immunofluorescence Microscopy:

    • Use antibodies against PTC2 or epitope tags for fixed-cell imaging

    • Co-staining with markers for different cellular compartments (ER, Golgi, endosomes, plasma membrane)

    • Confocal or super-resolution microscopy for detailed localization studies

  • Vesicular Trafficking Studies:

    • Based on findings from Drosophila studies, PTC2 trafficking may involve multivesicular bodies (MVBs) and ESCRT machinery

    • Investigate co-localization with markers of the ESCRT complex and SNARE proteins

    • Use inhibitors of different trafficking pathways to determine requirements for PTC2 transport

Research in Drosophila has shown that Patched localizes to discrete sites along cytonemes (filopodia-like structures) and that its transport requires MVB formation via ESCRT machinery . Similar approaches could be adapted to study PTC2 trafficking in Cynops pyrrhogaster cells, potentially revealing specialized mechanisms associated with regenerative processes unique to amphibians.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.