Recombinant Cyprinus carpio ATP synthase subunit a (mt-atp6)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
mt-atp6; atp6; atpase6; mtatp6; ATP synthase subunit a; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Cyprinus carpio (Common carp)
Target Names
Target Protein Sequence
MMVSFFDQFASPSYLGIPNIAVAIALPWVLYPTPPARWINNRLITIQGWFINRFTNQLML PLNVGGHKWALLLASLMIFLITINMLGLLPYTFTPTTQLSLNMGFAVPLWLATVIIGMRN QPTIALGHLLPEGTPIPLIPVLIIIETISLLIRPLALGVRLTANLTAGHLLIQLIATAVF VLLPMMPTVAILTAAVLFLLTLLEVAVAMIQAYVFVLLLSLYLQENV
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F1F0 ATP synthase or Complex V) synthesizes ATP from ADP using the proton gradient across the mitochondrial membrane, generated by the respiratory chain's electron transport complexes. F-type ATPases comprise two domains: the extramembranous catalytic F1 domain and the membrane-bound proton channel F0 domain, connected by a central and a peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits. A key component of the proton channel, this subunit likely plays a direct role in proton translocation across the membrane.
Database Links

KEGG: ccar:807763

Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Cyprinus carpio ATP synthase subunit a (mt-atp6)?

Recombinant Cyprinus carpio ATP synthase subunit a (mt-atp6) is a protein derived from common carp (Cyprinus carpio), spanning amino acids 1-227 (P24946). For research applications, it is typically expressed in E. coli with an N-terminal His tag for purification purposes . This mitochondrial protein is a critical component of the ATP synthase complex, which is responsible for ATP production during oxidative phosphorylation. Unlike commercially sourced information, researchers should understand that this recombinant protein maintains the structural and functional characteristics of the native protein while allowing for controlled experimental conditions.

How is Recombinant Cyprinus carpio ATP synthase subunit a (mt-atp6) typically expressed and purified?

Recombinant Cyprinus carpio ATP synthase subunit a (mt-atp6) is commonly expressed in bacterial expression systems, particularly E. coli, as evidenced by commercial preparations . The methodology involves:

  • Cloning the coding sequence (amino acids 1-227) into an appropriate expression vector

  • Incorporating an N-terminal His tag for affinity purification

  • Transforming the construct into E. coli expression strains

  • Inducing protein expression under optimized conditions

  • Lysing cells and purifying the protein using nickel affinity chromatography

  • Verifying purity using SDS-PAGE (typically >85% purity)

For research applications requiring higher purity, additional purification steps such as ion exchange chromatography or size exclusion chromatography may be necessary.

What are the optimal storage conditions for Recombinant Cyprinus carpio ATP synthase subunit a?

Based on protocols established for similar recombinant proteins, the following storage recommendations apply to maintain protein stability and activity :

  • Short-term storage (up to one week): 4°C in an appropriate buffer

  • Long-term storage: -20°C/-80°C with 5-50% glycerol as a cryoprotectant

  • Avoid repeated freeze-thaw cycles to prevent protein degradation

  • Aliquot the protein solution before freezing to minimize freeze-thaw cycles

For reconstitution, it is recommended to centrifuge the vial briefly before opening and reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. The shelf life is typically 6 months for liquid formulations and 12 months for lyophilized formulations when stored at -20°C/-80°C .

How does mt-atp6 differ from other ATP synthase subunits in Cyprinus carpio?

The ATP synthase complex in Cyprinus carpio contains multiple subunits with distinct functions:

SubunitLocationFunctionSizeKey Features
mt-atp6 (a)MitochondrialForms the proton channel227 aaMembrane-embedded
ATP5B (β)MitochondrialCatalytic activityPartialContains nucleotide binding sites
ATP5A1 (α)MitochondrialRegulatory function551 aaN-terminal region has antibacterial properties

The mt-atp6 subunit is specifically involved in proton translocation across the inner mitochondrial membrane, which is essential for the rotational mechanism of ATP synthesis. Unlike the β subunit (ATP5B) that directly participates in ATP catalysis, mt-atp6 facilitates the proton flow that drives the rotational motion .

What roles does the mt-atp6 play in mitochondrial translation and quality control mechanisms?

The mt-atp6 gene and its protein product are integral to studying co-translational quality control mechanisms in mitochondria. Research has shown that:

  • The mt-atp6 mRNA exists within a tricistronic transcript that includes MT-ATP8 and MT-CO3

  • This tricistronic transcript preferentially associates with mitochondrial ribosomes (55S monosomes) during translation

  • Proper membrane insertion of the nascent mt-atp6 protein depends on the OXA1L insertase

  • Failed membrane insertion triggers rapid degradation by the AFG3L2 protease complex

When investigating mitochondrial translation quality control, researchers can use mt-atp6 as a model substrate because:

  • It requires co-translational membrane insertion

  • Its stability is highly dependent on proper membrane integration

  • Pathogenic variants provide natural models for studying quality control mechanisms

  • The protein's degradation pathways are well-characterized and can be experimentally manipulated

How can pathogenic variants of mt-atp6 be used to study mitochondrial protein synthesis?

Pathogenic variants of mt-atp6 serve as valuable research tools for investigating mitochondrial protein synthesis mechanisms:

Experimental approaches to study these variants include:

  • siRNA knockdown of quality control factors (AFG3L2, OXA1L)

  • Metabolic labeling with 35S methionine/cysteine

  • In vitro translation assays using bacterial PURE systems with engineered constructs

  • Northern blotting and poisoned primer extension assays to analyze mRNA association with ribosomes

What methodologies can be employed to study the interaction between mt-atp6 and translational regulators?

Research on the regulation of mt-atp6 translation has identified several methodological approaches:

  • Genetic screens for translational regulators:

    • Extragenic suppressor screens using arginine-independent growth selection

    • Creation of double mutants (e.g., arg8, atp12) with mitochondrial gene substitutions

    • Complementation analysis to identify recessive versus dominant suppressors

  • Protein-RNA interaction analysis:

    • Extraction of mitochondria with digitonin

    • Affinity purification of potential regulatory proteins (e.g., Smt1p)

    • RT-PCR amplification with primers specific for ATP8/ATP6 mRNA

    • Analysis of mRNA co-immunoprecipitation

  • Ribosome association studies:

    • Sucrose density gradient preparation to isolate mitochondrial ribosomes

    • Northern blotting of pooled fractions

    • Poisoned primer extension assays for single-nucleotide resolution of mRNAs

    • Strand-specific reverse transcription followed by semi-quantitative PCR

These methodologies provide researchers with tools to investigate how mt-atp6 translation is regulated and how this regulation contributes to ATP synthase assembly and function.

How can the antibacterial properties of ATP synthase subunits inform research on mt-atp6?

While direct antibacterial properties have not been reported for mt-atp6 specifically, research on the related ATP5A1 (α subunit) provides insights that could inform mt-atp6 research:

  • Structural determinants of activity:

    • The N-terminal 65 residues of ATP5A1 are critical for antibacterial activity

    • This region disrupts bacterial membranes through depolarization and permeabilization

    • Similar structural analyses could be performed on mt-atp6 to identify functional domains

  • Evolutionary conservation:

    • The antibacterial activity of ATP5A1's N-terminal region is conserved throughout animal evolution

    • Comparative analysis of mt-atp6 across species could reveal conserved functional domains

    • Such analysis may identify novel functions beyond ATP synthesis

  • Experimental approaches:

    • Recombinant expression of specific domains

    • Bacterial growth inhibition assays

    • Membrane depolarization measurements

    • Microinjection of recombinant proteins into embryos for in vivo assessment

These studies suggest that ATP synthase subunits may have multifunctional roles beyond energy production, which could extend to mt-atp6 as well.

What are the key considerations for designing in vitro translation assays for mt-atp6?

When designing in vitro translation assays for mt-atp6, researchers should consider:

  • Translation system selection:

    • Complete reconstituted translation systems for human mitochondria are not yet available

    • Bacterial PURE systems can be adapted by incorporating mitochondrial sequence elements

    • The construct design should include appropriate flanking regions from the tricistronic transcript

  • Reporter system design:

    • Fusion constructs with reporter genes (e.g., DHFR, bla) facilitate detection

    • Stop codons should be modified based on experimental questions

    • Ribosomal binding sites must be appropriately positioned

  • Controls and variants:

    • Wild-type sequences

    • Single nucleotide additions/deletions to test reading frame effects

    • Pathogenic variants (e.g., ΔTA to generate fusion ORFs)

  • Detection methods:

    • Radioactive labeling for highly sensitive detection

    • Western blotting with antibodies against tags or fusion partners

    • Mass spectrometry for detailed characterization of translation products

Construct DesignExpected OutcomeApplications
Wild-type mt-atp6Normal translation terminationBaseline control
+A variantDistinct stop and start codonsTesting reading frame effects
ΔTA variantFusion ORF generationModeling pathogenic variants
mt-atp6-DHFR fusionDetectable reporter proteinQuantitative analysis

How should researchers approach the study of mt-atp6 co-translational membrane insertion?

Studying the co-translational membrane insertion of mt-atp6 requires specialized approaches:

  • Knockdown/knockout strategies:

    • siRNA knockdown of key insertion factors (OXA1L)

    • siRNA knockdown of quality control proteases (AFG3L2)

    • Single and combined knockdowns to dissect the roles of different factors

  • Metabolic labeling:

    • Pulse-chase experiments with 35S methionine/cysteine

    • Short labeling periods (5-30 minutes) to capture co-translational events

    • Analysis of nascent chain stability over time

  • Membrane integration assays:

    • Carbonate extraction to distinguish membrane-integrated from peripheral proteins

    • Protease protection assays to determine topology

    • Blue native PAGE to assess complex assembly

  • Ribosome-nascent chain complex (RNC) analysis:

    • Isolation of RNCs through sucrose gradient centrifugation

    • Analysis of associated proteins (insertases, chaperones)

    • Characterization of mRNA association with different ribosomal fractions

These methodological approaches allow researchers to dissect the complex process of mt-atp6 membrane insertion and the quality control mechanisms that ensure proper protein biogenesis.

How should researchers interpret conflicting results regarding mt-atp6 function across different species?

When encountering conflicting results about mt-atp6 function across species, researchers should consider:

  • Evolutionary divergence:

    • ATP synthase subunits can acquire species-specific functions while maintaining core roles

    • The N-terminal regions of ATP synthase subunits show particular evolutionary plasticity

    • Functional assays should be interpreted within the evolutionary context of the species studied

  • Experimental system differences:

    • In vitro versus in vivo studies may yield different results

    • Heterologous expression systems may lack species-specific factors

    • Cell type-specific effects should be considered when comparing results

  • Resolution approach:

    • Conduct comparative studies using consistent methodologies

    • Perform phylogenetic analyses to identify conserved versus divergent domains

    • Use complementation studies across species to test functional conservation

    • Design chimeric proteins to map species-specific functional domains

  • Data integration:

    • Construct functional models that accommodate species-specific findings

    • Distinguish core conserved functions from accessory roles

    • Consider how experimental conditions might influence observed functions

What statistical approaches are most appropriate for analyzing mt-atp6 translation and stability data?

When analyzing data related to mt-atp6 translation and stability, researchers should employ the following statistical approaches:

  • For pulse-chase experiments:

    • Nonlinear regression analysis for protein half-life determination

    • Two-way ANOVA to assess the effects of multiple factors (e.g., knockdown and time)

    • Post-hoc tests (e.g., Tukey's or Bonferroni) for multiple comparisons

  • For ribosome association studies:

    • Quantification of mRNA distribution across gradient fractions

    • Normalization to total mRNA or to specific reference transcripts

    • Chi-square analysis for comparing distribution patterns

  • For in vitro translation assays:

    • Densitometric analysis of gel bands

    • Calculation of relative synthesis rates

    • Paired t-tests for comparing wild-type and variant constructs

  • Replication and power:

    • Minimum of three biological replicates for statistical validity

    • Power analysis to determine appropriate sample sizes

    • Consideration of technical variability in experimental design

These statistical approaches ensure robust interpretation of experimental data relating to mt-atp6 translation, stability, and function.

What emerging technologies could advance our understanding of mt-atp6 function and regulation?

Several cutting-edge technologies hold promise for advancing research on mt-atp6:

  • Cryo-electron microscopy:

    • High-resolution structural analysis of mt-atp6 within the ATP synthase complex

    • Visualization of conformational changes during proton translocation

    • Structural insights into pathogenic variant effects

  • CRISPR-based mitochondrial genome editing:

    • Precise modification of mt-atp6 in cellular models

    • Creation of isogenic cell lines with pathogenic variants

    • Study of variant effects in the native genomic context

  • Ribosome profiling for mitochondrial translation:

    • Genome-wide analysis of translation kinetics

    • Identification of translation pause sites

    • Characterization of co-translational quality control mechanisms

  • Single-molecule techniques:

    • Real-time observation of mt-atp6 synthesis and membrane insertion

    • Analysis of protein-protein interactions during co-translational events

    • Quantification of protein stability and turnover at the single-molecule level

These technologies will enable researchers to address fundamental questions about mt-atp6 function, regulation, and quality control with unprecedented precision and comprehensiveness.

How might studies on mt-atp6 inform therapeutic approaches for mitochondrial diseases?

Research on mt-atp6 has significant implications for developing therapies for mitochondrial diseases:

  • Targeted protein replacement:

    • Understanding the co-translational quality control of mt-atp6 could inform approaches for delivering functional proteins to mitochondria

    • Recombinant mt-atp6 with enhanced stability might serve as a therapeutic protein

  • Modulation of quality control mechanisms:

    • Inhibition of AFG3L2 could potentially stabilize partially functional mt-atp6 variants

    • Enhancement of OXA1L function might improve membrane insertion of problematic variants

  • Gene therapy approaches:

    • Targeting nuclear genes encoding translational regulators

    • Development of mitochondrially-targeted RNA therapeutics

    • Allotopic expression of engineered mt-atp6 from the nucleus

  • Drug screening platforms:

    • Cell-based assays using mt-atp6 pathogenic variants

    • In vitro translation systems for high-throughput compound screening

    • Assessment of compounds that promote read-through of premature termination codons or suppress frameshift effects

By elucidating the fundamental mechanisms of mt-atp6 synthesis, membrane insertion, and quality control, researchers can identify novel therapeutic targets and strategies for treating mitochondrial diseases caused by mt-atp6 mutations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.