Recombinant Cyprinus carpio Cytochrome c oxidase subunit 2 (mt-co2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks; we will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mt-co2; coii; coxii; mtco2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Cyprinus carpio (Common carp)
Target Names
Target Protein Sequence
MAHPTQLGFKDAAMPVMEELLHFHDHALMIVLLISTLVLYIITAMVSTKLTNKYILDSQE IEIVWTILPAVILVLIALPSLRILYLMDEINDPHLTIKAMGHQWYWSYEYTDYENLGFDS YMVPTQDLAPGQFRLLETDHRMVVPMESPVRVLVSAEDVLHSWAVPSLGVKMDAVPGRLN QAAFIASRPGVFYGQCSEICGANHSFMPIVVEAVPLEHFENWSSLMLEDA
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 2 (COX2) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain (ETC). The ETC, comprised of Complexes I-IV, facilitates oxidative phosphorylation by transferring electrons from NADH and succinate to molecular oxygen. This process generates an electrochemical gradient across the inner mitochondrial membrane, driving ATP synthesis. COX2 plays a crucial role in the final step, catalyzing the reduction of oxygen to water. Electrons from reduced cytochrome c (in the intermembrane space) are transferred via the CuA center (subunit 2) and heme a (subunit 1) to the binuclear center (BNC) in subunit 1, containing heme a3 and CuB. The BNC utilizes four electrons from cytochrome c and four protons from the mitochondrial matrix to reduce oxygen to two water molecules.
Database Links

KEGG: ccar:807772

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Cytochrome c oxidase subunit 2 in Cyprinus carpio and what is its primary function?

Cytochrome c oxidase subunit 2 (MT-CO2) in Cyprinus carpio is a mitochondrial-encoded protein that serves as a critical component of the respiratory chain. It functions as part of Complex IV (cytochrome c oxidase), which catalyzes the final step of the electron transport chain - the reduction of molecular oxygen to water. The protein contains 230 amino acids in Cyprinus carpio and plays a crucial role in cellular energy production .

MT-CO2 transfers electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1, forming a functional core of the enzyme complex along with subunits 1 and 3 . In the respiratory chain, this process couples electron transfer with proton translocation across the membrane, contributing to the generation of the electrochemical gradient used for ATP synthesis.

What are the optimal conditions for reconstituting lyophilized recombinant Cyprinus carpio MT-CO2?

For optimal reconstitution of lyophilized recombinant Cyprinus carpio MT-CO2:

  • Briefly centrifuge the vial before opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (recommended: 50%) for long-term storage stability

  • Aliquot the reconstituted protein to minimize freeze-thaw cycles

  • Store working aliquots at 4°C for up to one week

  • For long-term storage, keep aliquots at -20°C/-80°C

The reconstitution buffer typically contains Tris/PBS-based buffer with 6% trehalose at pH 8.0, which helps maintain protein stability. Avoid repeated freeze-thaw cycles as they can cause protein degradation and loss of activity. For applications requiring higher purity, additional purification steps using size exclusion chromatography or ion exchange chromatography may be necessary.

What analytical methods are most effective for verifying the purity and activity of recombinant Cyprinus carpio MT-CO2?

Multiple complementary analytical methods are recommended to verify the purity and activity of recombinant Cyprinus carpio MT-CO2:

Purity Assessment:

  • SDS-PAGE: Should show >90% purity with a single band at approximately 26 kDa

  • Western blotting: Using anti-His tag or anti-MT-CO2 specific antibodies

  • HPLC: For quantitative purity assessment

  • Mass spectrometry: To confirm molecular weight and sequence integrity

Activity Assessment:

  • Cytochrome c oxidase activity assay: Measures the oxidation of reduced cytochrome c by monitoring the decrease in absorbance at 550 nm

  • Oxygen consumption assay: Using an oxygen electrode to measure enzyme activity

  • Spectroscopic analysis: Examining characteristic absorption peaks of the heme groups

Functional Verification:

  • Reconstitution into liposomes to assess membrane integration and proton pumping activity

  • Electron transfer assays using artificial electron donors and acceptors

  • Thermal stability assays to assess proper protein folding

A comprehensive assessment should include at least one method from each category to ensure both structural integrity and functional activity of the recombinant protein.

How can recombinant Cyprinus carpio MT-CO2 be used in studies of mitochondrial function under hypoxic conditions?

Recombinant Cyprinus carpio MT-CO2 provides a valuable tool for investigating mitochondrial adaptations to hypoxia, particularly because common carp are known for their tolerance to low-oxygen environments. Methodological approaches include:

  • Comparative structural studies: Using the recombinant protein to analyze structural differences between carp MT-CO2 and that of hypoxia-sensitive species

  • In vitro reconstitution experiments: Incorporating recombinant MT-CO2 into artificial membrane systems with varying oxygen tensions to measure:

    • Oxygen binding affinity changes

    • Electron transfer rates under different oxygen concentrations

    • Proton translocation efficiency

  • Mutational analysis: Creating site-directed mutants of key residues to identify those critical for hypoxia tolerance

  • Protein-protein interaction studies: Using pull-down assays with the His-tagged recombinant protein to identify potential regulatory partners that might modulate activity under hypoxic conditions

  • Comparative expression studies: Using antibodies against the recombinant protein to quantify MT-CO2 expression levels in tissues exposed to normoxic vs. hypoxic conditions

Recent research has shown that carp can maintain mitochondrial function at oxygen levels that would impair function in mammals, making this protein particularly valuable for understanding adaptations to hypoxic environments in aquatic species.

What is the relationship between MT-CO2 expression and CO2 tolerance in common carp during environmental challenges?

Studies investigating the relationship between MT-CO2 expression and CO2 tolerance in common carp have revealed complex physiological adaptations:

  • Expression pattern correlation: RT-qPCR analysis has shown that MT-CO2 expression patterns change in response to elevated environmental CO2. In carbon dioxide challenge experiments, common carp exposed to CO2 concentrations of approximately 100 mg/L showed altered MT-CO2 gene expression in gill and liver tissues .

  • Behavioral response mechanisms: Common carp exposed to CO2 injection exhibited distinct behavioral states that can be analyzed using hidden Markov models (HMMs). These states correlate with changes in mitochondrial gene expression, including MT-CO2 .

TreatmentBehavioral StateStep LengthTurning Angle DistributionExit Time from LockMT-CO2 Expression Change
CO2 with forced water circulationEncamped/ExploratoryShorterUnimodalVariableUpregulated in gills
Forced water circulation onlyExploratoryLongerBroaderConsistentNo significant change
No treatment (null)MixedVariableVariableInconsistentBaseline
  • Physiological adaptation mechanisms: MT-CO2 upregulation appears to be part of a compensatory response to maintain electron transport chain efficiency during high CO2 exposure, potentially through:

    • Enhanced binding efficiency for oxygen

    • Modified proton pumping activity

    • Altered interaction with other respiratory chain components

  • Integration with immune response: During environmental challenges, MT-CO2 expression changes correlate with immune gene expression patterns, suggesting coordinated responses to multiple stressors .

The research indicates that MT-CO2 plays a role in physiological adaptation to elevated CO2, which has implications for understanding carp resilience in eutrophic environments and potential impacts of climate change on aquatic ecosystems.

What are the common challenges in expressing and purifying recombinant Cyprinus carpio MT-CO2 in E. coli systems?

Expressing and purifying recombinant Cyprinus carpio MT-CO2 in E. coli presents several challenges that researchers should anticipate and address:

  • Membrane protein solubility issues:

    • MT-CO2 is naturally a membrane-integrated protein, making it prone to aggregation in E. coli

    • Solution: Use of fusion partners (MBP, SUMO, etc.) can improve solubility

    • Alternative: Expression in inclusion bodies followed by refolding protocols

  • Codon usage bias:

    • Differences in codon usage between Cyprinus carpio and E. coli

    • Solution: Codon optimization of the expression construct or use of E. coli strains with rare tRNA genes (e.g., Rosetta™)

  • Lack of post-translational modifications:

    • E. coli lacks machinery for eukaryotic-like modifications

    • Assessment: Verify functional properties despite absence of modifications

    • Alternative: Consider insect cell or yeast expression systems for certain applications

  • Improper folding:

    • Solution: Co-expression with chaperones (GroEL/ES, DnaK/J)

    • Protocol: Expression at lower temperatures (16-25°C) to slow protein synthesis and allow proper folding

  • Heme incorporation:

    • E. coli may not efficiently incorporate heme groups

    • Solution: Supplementation of growth media with δ-aminolevulinic acid (ALA) to enhance heme biosynthesis

    • Alternative: In vitro heme reconstitution after purification

  • Purification challenges:

    • His-tag accessibility may be limited due to protein folding

    • Solution: Consider dual tagging (e.g., His-tag and another affinity tag)

    • Protocol: Use denaturing conditions initially, followed by on-column refolding

Proper expression and purification typically require optimization of multiple parameters, including induction conditions (IPTG concentration, temperature, duration), lysis buffers, and purification protocols specific to membrane proteins.

How can researchers design effective experiments to study the interaction between recombinant MT-CO2 and other components of the respiratory chain?

Designing effective experiments to study interactions between recombinant MT-CO2 and other respiratory chain components requires a multi-faceted approach:

  • Protein-protein interaction studies:

    • Co-immunoprecipitation using antibodies against MT-CO2 or the His-tag

    • Pull-down assays with immobilized recombinant MT-CO2

    • Surface plasmon resonance (SPR) for quantitative binding kinetics

    • Protocol: Crosslinking prior to analysis can capture transient interactions

  • Reconstitution systems:

    • Liposome reconstitution with purified components

    • Nanodiscs incorporation for stable membrane environments

    • Methodology: Measure electron transfer rates between reconstituted components using spectrophotometric assays

  • Structural analysis of complexes:

    • Cryo-electron microscopy of reconstituted complexes

    • X-ray crystallography attempts with stabilized complexes

    • Note: Use of amphipols or detergent screens to maintain complex integrity

  • Functional coupling measurements:

    • Oxygen consumption assays in reconstituted systems

    • Membrane potential measurements using voltage-sensitive dyes

    • Proton pumping activity measurements using pH-sensitive fluorophores

  • Mutational analysis for interaction mapping:

    • Site-directed mutagenesis of predicted interaction sites

    • Analysis grid:

Mutation SitePredicted Interaction PartnerBinding Affinity ChangeFunctional Impact
Copper-binding domainCytochrome cMeasure by SPRElectron transfer rate
Transmembrane helicesMT-CO1/MT-CO3Co-IP efficiencyAssembly efficiency
C-terminal domainAssembly factorsPull-down efficiencyComplex stability
  • In silico modeling validation:

    • Molecular dynamics simulations of interactions

    • Docking studies to predict interaction interfaces

    • Experimental validation of predicted interaction sites

These approaches should be used in combination, as each provides complementary information about the complex interactions within the respiratory chain. Controls should include known interaction partners and non-interacting proteins to establish specificity.

How does the structure and function of recombinant Cyprinus carpio MT-CO2 compare to that of other fish species and mammals?

Comparative analysis of Cyprinus carpio MT-CO2 with other species reveals important evolutionary adaptations and functional conservation:

  • Sequence homology analysis:

SpeciesSequence Identity to Carp MT-CO2Length (aa)Key Functional Differences
Human (Homo sapiens)~60%227Additional regulatory sites
Zebrafish (Danio rerio)~85%230Highly conserved functional domains
Rat (Rattus norvegicus)~62%227Different copper-binding residues
Bovine (Bos taurus)~61%227Well-studied crystallographic model
Arvicanthis somalicus~59%227Different N-terminal region
  • Structural comparison:

    • Fish MT-CO2 proteins generally have similar secondary structure elements

    • Transmembrane topology is highly conserved across species

    • The copper A (CuA) binding site shows structural conservation in all vertebrates

    • Crystal structure studies of bovine cytochrome c oxidase (2.3 Å resolution) provide insight into conserved functional domains

  • Functional adaptations:

    • Carp MT-CO2 shows adaptations consistent with hypoxia tolerance

    • Mammalian MT-CO2 typically operates at higher temperatures (37°C vs. variable in fish)

    • Carp MT-CO2 may have enhanced efficiency at lower temperatures

    • Different regulatory mechanisms for activity modulation between fish and mammals

  • Environmental adaptation signatures:

    • Fish MT-CO2 shows amino acid substitutions in regions associated with proton channels

    • These substitutions may reflect adaptation to different ecological niches

    • Carp-specific adaptations correlate with their ability to survive in low-oxygen environments

This comparative analysis provides insights into the evolutionary conservation of core functional domains while highlighting species-specific adaptations that reflect different physiological requirements and environmental adaptations.

How can recombinant Cyprinus carpio MT-CO2 be used as a model system for studying mitochondrial disorders in humans?

Recombinant Cyprinus carpio MT-CO2 offers a valuable model system for investigating mitochondrial disorders in humans through several methodological approaches:

  • Functional conservation as research foundation:

    • Despite sequence divergence, the fundamental electron transfer mechanism is conserved

    • Core functional domains show high homology between species

    • Allows modeling of basic disease mechanisms in a simpler system

  • Disease-associated mutation modeling:

    • Human MT-CO2 mutations associated with mitochondrial complex IV deficiency (MT-C4D) can be introduced into equivalent positions in carp MT-CO2

    • Effects on protein stability, assembly, and function can be assessed in vitro

    • Functional assays:

      • Electron transfer efficiency

      • Oxygen consumption rates

      • Proton pumping activity

      • Complex assembly efficiency

  • Comparative biochemical analysis workflow:

Human Disease MutationEquivalent Position in Carp MT-CO2Functional AssayExpected OutcomeClinical Correlation
M29KSimilar positionEnzyme activityReduced activityMELAS-like symptoms
R159HConserved arginineAssembly analysisImpaired assemblyLeigh syndrome
V191IConserved regionOxygen bindingAltered O₂ affinityExercise intolerance
  • Advantages of the carp model:

    • Higher protein yield in recombinant systems

    • Tolerance to structural perturbations may reveal compensatory mechanisms

    • Temperature flexibility allows studying thermal stability of mutants

    • Simpler genetic background for isolating specific effects

  • Complementary approaches:

    • Parallel studies with human and carp MT-CO2 to identify conserved and divergent responses

    • Structure-guided design of therapeutic interventions

    • Screening of small molecule modulators of cytochrome c oxidase activity

This model system provides a valuable alternative to mammalian systems for initial characterization of disease-associated mutations, with the potential to accelerate our understanding of mitochondrial disorders and the development of therapeutic strategies.

What novel applications of recombinant Cyprinus carpio MT-CO2 are emerging in environmental monitoring and ecotoxicology?

Emerging applications of recombinant Cyprinus carpio MT-CO2 in environmental monitoring and ecotoxicology show promising developments:

  • Biomarker development for aquatic pollutants:

    • Recombinant MT-CO2 can be used to develop antibodies for detecting native protein expression changes in wild carp

    • These biomarkers can indicate mitochondrial stress in fish exposed to environmental contaminants

    • Correlation studies have linked MT-CO2 expression changes with exposure to heavy metals, pesticides, and industrial effluents

  • In vitro toxicity screening systems:

    • Direct interaction assays between recombinant MT-CO2 and environmental contaminants

    • Measuring inhibition of enzymatic activity as an indicator of mitochondrial toxicity

    • High-throughput screening potential for environmental sample testing

  • Carbon dioxide impact assessment tools:

    • Studies utilizing recombinant MT-CO2 have revealed mechanisms of CO₂ impact on respiratory function

    • Applications in monitoring rising aquatic CO₂ levels due to climate change

    • Assessment parameters:

CO₂ ConcentrationEffect on MT-CO2 ActivityBehavioral ResponseEcological Implication
Ambient (~5 mg/L)Baseline activityNormalReference condition
Moderate (50-100 mg/L)Compensatory upregulationAvoidance behaviorHabitat restriction
High (>100 mg/L)InhibitionStress responsePopulation impacts
  • Integration with fish farm management:

    • MT-CO2 expression analysis can serve as indicators of metabolic stress in aquaculture settings

    • Applications in optimizing carbon capture in fish farms while monitoring fish health

    • Potential for developing recombinant MT-CO2-based biosensors for continuous monitoring

  • Water quality assessment frameworks:

    • Standardized assays using recombinant MT-CO2 activity to assess water quality

    • Correlation with established parameters of aquatic ecosystem health

    • Early warning systems for mitochondrial toxicants in water sources

These emerging applications represent an intersection between basic biochemical research and applied environmental science, with potential to develop into standardized monitoring tools for aquatic ecosystem health assessment.

How might advances in structural biology techniques enhance our understanding of recombinant Cyprinus carpio MT-CO2 and its interactions?

Recent advances in structural biology techniques offer unprecedented opportunities to enhance our understanding of recombinant Cyprinus carpio MT-CO2:

  • Cryo-electron microscopy (Cryo-EM) applications:

    • Single-particle analysis can resolve MT-CO2 structure without crystallization

    • Potential to visualize dynamic states during the catalytic cycle

    • Technical approach: Sample preparation with detergent micelles or nanodiscs

    • Recent advances have achieved resolutions of ~2.3Å for membrane proteins comparable to cytochrome c oxidase

  • Integrative structural biology approach:

    • Combining X-ray crystallography data from related proteins

    • NMR for dynamics of specific domains

    • Mass spectrometry for protein-protein interactions

    • Computational modeling to integrate diverse structural data

    • Output: Complete functional model of MT-CO2 in various conformational states

  • Time-resolved spectroscopy advancements:

    • Femtosecond-resolved spectroscopy to capture electron transfer events

    • Correlation with structural changes during catalytic cycle

    • Experimental design: Triggered reactions with laser pulses followed by spectroscopic measurement

  • Serial femtosecond crystallography potential:

    • Room-temperature structural studies that avoid radiation damage

    • Capability to capture transient intermediates during oxygen reduction

    • Similar studies with bovine cytochrome c oxidase have revealed active site configurations

    • Advantage: Reveals physiologically relevant conformations without cryogenic artifacts

  • In silico structure-function prediction:

    • Molecular dynamics simulations of MT-CO2 in membrane environments

    • Prediction of conformational changes during catalytic cycle

    • Virtual screening for potential modulators of activity

    • Integration with experimental validation

These advanced techniques, individually and in combination, promise to reveal not only static structural information but also the dynamic aspects of MT-CO2 function, potentially leading to breakthroughs in understanding the fundamental mechanisms of cellular respiration and species-specific adaptations in energy metabolism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.